SecReT4
Protein ID: 134287614
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7116
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]81120..82130 [+]
Producthypothetical protein
Component typeTrbL
UniProt IDA4JUP6
KEGG IDbvi:Bcep1808_7116
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.3e-17, Aligned region: 91..311
Protein Sequence: 336 a.a.     [Download]
>gi|134287614|ref|YP_001109780.1| hypothetical protein Bcep1808_7116 [Burkholderia vietnamiensis G4]
MRRGMMRQWLPSGLLLIALVLPTVARAALQDTLTQFGTTGWSSSYVVGEVAKGAMAAIEEITKLMTDLID
LAVTVSKSLEKDSDKMAGGLATITIIVAFLRFAATKDPVAAWGSAFEDLAVLGIFASVYLAYGTWAPGFY
KWFNDLAVAVSGTDAQSLPMAMVKSAGAIFDAVNEALKAEHWWNYVALVINLIPLLAAWFILMVASLVFL
FYVSLGTIQMAVAIVMGKIAFALGMSEFTRGWFKSWLDFTIGAGMYMVVAAILQRLMTTTLATTFGNTIS
KGLTTPYAGSLTLDLSIFVLILAFEIPKFASMFGGGASASGAAFKSLTKLATKGMV
 
Nucleotide Sequence: 1011 bp     [Download]
>gi|134287530|ref|NC_009227.1|:81120-82130 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGAGGCGCGGAATGATGCGTCAGTGGCTGCCGAGTGGCCTGCTTCTCATCGCGCTTGTGCTCCCGACAG
TAGCCCGGGCTGCCCTGCAGGATACGCTAACCCAATTTGGAACAACCGGCTGGAGTTCAAGCTACGTGGT
CGGCGAGGTCGCGAAGGGCGCGATGGCGGCAATCGAAGAGATCACGAAACTGATGACGGATCTGATCGAT
CTCGCAGTTACGGTCAGCAAGTCGCTTGAGAAAGATTCGGACAAGATGGCGGGAGGGCTTGCGACCATCA
CCATTATCGTGGCGTTTCTCCGTTTCGCAGCGACGAAGGATCCGGTTGCCGCTTGGGGCAGCGCCTTTGA
AGACCTTGCCGTACTCGGCATCTTCGCGTCCGTCTATCTCGCCTACGGTACGTGGGCGCCCGGCTTCTAC
AAGTGGTTCAACGACTTGGCGGTCGCGGTCTCGGGGACCGACGCGCAATCTCTGCCAATGGCGATGGTGA
AGTCGGCAGGGGCAATATTCGATGCGGTCAATGAAGCGCTGAAGGCCGAGCACTGGTGGAACTACGTCGC
CCTGGTAATCAATCTGATTCCGCTTCTCGCCGCGTGGTTCATTCTGATGGTCGCATCGTTGGTGTTTCTG
TTCTATGTCTCGCTCGGCACGATCCAGATGGCTGTTGCAATCGTGATGGGGAAAATTGCGTTCGCGCTCG
GCATGTCGGAGTTTACGCGTGGTTGGTTCAAGAGCTGGCTCGATTTCACGATCGGCGCTGGCATGTACAT
GGTTGTTGCCGCGATTCTTCAGCGGCTGATGACCACCACGCTTGCGACGACATTCGGAAACACCATCTCG
AAGGGGCTGACGACACCCTACGCTGGCTCTTTGACTCTCGATCTTTCGATCTTCGTTTTGATCCTCGCGT
TCGAAATTCCGAAGTTTGCCTCGATGTTCGGTGGCGGCGCCAGCGCAAGCGGTGCGGCGTTCAAGAGCCT
GACGAAACTGGCGACGAAGGGCATGGTTTGA
 Primer design