SecReT4
Protein ID: 134287616
T4SS name [ID]Trb [776]
Gene symbol-
Locus tagBcep1808_7118
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE02 [GenBank: NC_009227] [Browse all T4SS(s) in this replicon]
Location [Strand]83452..85320 [+]
Producthypothetical protein
Component typeTraG
UniProt IDA4JUP8
KEGG IDbvi:Bcep1808_7118
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 2.1e-20, Aligned region: 472..599
TrwB_AAD_bind [PF10412], Evalue: 6.9e-18, Aligned region: 417..610
AAA_10 [PF12846], Evalue: 2.2e-09, Aligned region: 177..543
T4SS-DNA_transf [PF02534], Evalue: 3.7e-08, Aligned region: 421..590
Protein Sequence: 622 a.a.     [Download]
>gi|134287616|ref|YP_001109782.1| hypothetical protein Bcep1808_7118 [Burkholderia vietnamiensis G4]
MRGYINHFRPIYEVRATIGWLIALFALPLSGMPYGGAFALFALALFAFRSGQVWRALKFRMGLSTKWLTT
LAVPTLLAIQNRMRAEVNAMYLGTGFEWTQKHCQMAHDILRMPTTEIPGLPKWLPKTKAGRAFEEMIENL
FAPKDSIRDRTPQGASWIHGLEPAKGHVPFHYKAMGGHTAVGGTTGSGKTRTYEVISTQVIHCGDVLIDI
DPKNDKEWKARAEREAKRTGRKFLYFNQAKPSESIRLEPLDSWSQPSEIPSRIAQLMEEGPFRDFAYLFI
SRSVNGELYIGDKPNLRSILKYAQLGIDPLLEKALKRFFIESGLTDWDELVTADTVKIANKPGSTRVDAM
ISLYQARFGANDRGHEAIDGLIATHVHDREHYMRIIASALPLLQMLATGETGLMLAPKVDDFEDEREIWT
IEKVIRQKAVLHIGLDSLSNSIVAKAIASMILADVSAVCGSIYNFYDSPPEVVLIIDEIAEAINEQVIQI
LNKGRGAGFKAFVAFQTRADLEAKLGNAAKMLQVLGNLNNQIILRLEDTDTAEWFSKKVGDTAIRNLIVS
SSTSKASEGHVGEFTGSVTRSQQLEAVPLIPTRLIQTLPNLQYFMRISGGAVYQGRIPILTG
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|134287530|ref|NC_009227.1|:83452-85320 Burkholderia vietnamiensis G4 plasmid pBVIE02, complete sequence
ATGAGGGGCTACATCAACCACTTTCGGCCGATCTACGAGGTACGCGCGACAATCGGTTGGCTGATTGCGC
TCTTCGCACTGCCGCTCTCGGGCATGCCGTACGGCGGGGCCTTCGCGCTGTTCGCTCTCGCGTTGTTCGC
GTTCCGCTCGGGGCAGGTCTGGCGCGCGCTCAAGTTTCGGATGGGGTTGTCGACGAAATGGCTGACAACG
TTGGCCGTACCCACGTTGCTCGCGATCCAGAACCGTATGCGTGCTGAAGTGAACGCGATGTACCTCGGCA
CCGGGTTCGAATGGACGCAAAAGCACTGCCAGATGGCCCACGACATTCTGCGGATGCCGACCACCGAGAT
CCCTGGGCTGCCGAAGTGGTTGCCCAAGACGAAGGCCGGACGCGCGTTCGAGGAGATGATCGAGAACCTC
TTTGCGCCGAAGGACAGTATTCGGGACCGGACGCCGCAAGGTGCATCGTGGATCCACGGCCTAGAGCCGG
CGAAAGGCCACGTGCCGTTCCACTACAAGGCGATGGGCGGCCATACGGCGGTCGGCGGCACGACTGGCTC
GGGCAAGACCCGGACCTACGAAGTCATCTCCACGCAGGTCATCCACTGCGGTGACGTGCTGATCGACATC
GATCCGAAGAACGACAAGGAGTGGAAGGCCCGCGCCGAGCGCGAAGCCAAGCGTACCGGTCGAAAGTTCC
TCTATTTCAATCAGGCGAAGCCGTCCGAGTCGATCCGACTCGAGCCGCTCGATAGCTGGTCCCAGCCATC
CGAAATTCCGAGCCGCATTGCGCAGCTGATGGAGGAGGGACCATTCCGGGATTTCGCGTATCTGTTCATT
AGCCGATCGGTCAACGGTGAACTGTACATCGGCGACAAGCCGAACCTGCGCTCGATCCTGAAGTACGCGC
AGCTCGGCATTGACCCGCTGCTGGAGAAGGCGCTCAAGCGCTTCTTCATCGAAAGTGGACTAACCGACTG
GGATGAGCTGGTAACGGCCGACACGGTCAAGATCGCGAACAAGCCGGGCTCCACGCGCGTCGACGCGATG
ATCTCGCTTTACCAGGCCCGGTTCGGCGCAAATGACCGGGGGCATGAAGCAATCGACGGCCTGATCGCGA
CGCACGTGCACGACCGCGAGCACTACATGCGAATCATCGCGTCGGCACTGCCGCTGCTGCAGATGCTCGC
CACCGGGGAAACCGGCCTGATGCTCGCGCCGAAGGTCGACGACTTCGAGGACGAACGCGAGATCTGGACG
ATCGAGAAGGTGATTCGCCAGAAGGCTGTCCTTCACATTGGCCTCGACTCGCTGTCCAACAGCATTGTCG
CGAAGGCCATCGCGTCGATGATCCTGGCCGACGTATCCGCGGTGTGCGGTTCGATCTACAACTTCTACGA
CTCGCCGCCAGAGGTCGTGCTGATCATCGACGAGATTGCGGAAGCGATCAACGAGCAGGTGATCCAAATC
CTGAACAAGGGCCGTGGCGCGGGCTTCAAGGCGTTCGTGGCGTTCCAGACGCGTGCCGACCTCGAAGCCA
AGCTGGGGAATGCGGCCAAAATGCTGCAGGTTTTGGGGAACCTGAACAATCAGATCATCTTACGCTTGGA
AGATACCGACACGGCTGAGTGGTTCTCGAAGAAGGTGGGGGATACCGCGATTCGCAACCTGATCGTCTCG
AGCAGTACGAGCAAGGCCAGCGAAGGCCACGTCGGCGAGTTCACCGGTTCGGTGACGCGGTCGCAGCAGC
TGGAGGCAGTGCCGTTGATTCCGACGCGCCTGATACAGACCCTTCCGAACCTGCAGTACTTCATGCGGAT
ATCGGGTGGCGCGGTGTACCAGGGACGTATTCCAATTCTTACAGGCTAA
 Primer design