SecReT4
Protein ID: 134287810
T4SS name [ID]Tra_I [180]
Gene symbol-
Locus tagBcep1808_7568
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE04 [GenBank: NC_009228] [Browse all T4SS(s) in this replicon]
Location [Strand]15372..18437 [-]
ProductTraU protein
Component typeTraU_I
UniProt IDA4JVZ0
KEGG IDbvi:Bcep1808_7568
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.1e-64, Aligned region: 496..896
Protein Sequence: 1021 a.a.     [Download]
>gi|134287810|ref|YP_001109975.1| TraU protein [Burkholderia vietnamiensis G4]
MGFLDKGVTAIEDTLAYLARYWIGKDFAGYCELATAVGLTEEDIKRHPGLKDPYIVVDNKLALLTAFDVQ
GTYQILSDQDFGKMIDNLRVKMNGYMKRYGHSITFGFERDPDRSLDELMRLVEPQINAARRIGLKSEDII
LDRVRRNAPLVAWEQNLMIVYTHMNVMSPEEMKRELKERSQEAQKHGLPRIDFGQNPASVLMAMKYRHDT
MIERVRHDFERCGSDGRPGIMLRPISAHEAIKRVRIMVNRERTSQKFRPVLPGDRFIPRGREDKRDHSDL
TAPPVNYQICTNDVTNHRELIKTDELWHGNLSMELGPQEPQPFSSLFASIDREIPWRVRIDLNPGGLNEM
RARQMMVAFVGMLPSNRQIRQSFIDLNERSKEDAICSMKFAVSTWSPSESVTKRRMAALEKSIQSWGICQ
VTSVHGDPMAAWASTIPGFTTKNVANRMVPPLPDALALLPLQRPATPWGDGGSLIVRTPDGKIYPIQLGS
RLQDTWIELISAPPGSGKSVLMNSMNSATVHRPGNVRLPLMTIIDVGPSSSGLIQLIKDSLPEHRKSEAA
YLRLQNSLEYATNPFDTQLGARFPTSREQEFLVDLLTLFCTDPATKKAPSGCSQVNEMLLRIAYEDRATK
NPHMYEPHIDRTVDAVLESSGLKTQYSEEWWSVAKWWEVTDMLFQAGYVREASLAQRQAVPILPDFGAYL
NDESIRDLFGEAKVPGTNEPLLKYMYRCFTVATSNYALFAGRTRFELNSETRIISIDLNDVIGGKTPEGM
LRTAAMYMFARQMAAKNYFLRDEVVLPVVPQMYQEYHLKRVADVQDEQKTIAYDEVHNTGGQEAFVQTMI
KDGREGRKWGIRIVNASQYLADYPTELLNAATAVYVMRGGNAADEEILRSVYSVSEEAIRRLQREAVGPG
PEGGNFLALFKTKVGFVVQLLTNTVGPIELWAFSTTQEDVALRNRLYKRIGPYEARKLLSEHFPLGTALE
TIEHMRAESSEKEDVSVIERLASKLVERYTRKITKQRELVE
 
Nucleotide Sequence: 3066 bp     [Download]
>gi|134287794|ref|NC_009228.1|:c18437-15372 Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence
ATGGGCTTTCTGGACAAGGGTGTAACCGCGATCGAGGACACGCTCGCTTATCTCGCGCGTTACTGGATCG
GCAAGGACTTCGCCGGATACTGCGAGCTGGCGACGGCCGTGGGCCTCACGGAAGAAGACATCAAGCGGCA
CCCGGGCCTGAAAGACCCGTACATCGTGGTCGATAACAAGCTCGCGCTGCTGACCGCGTTCGACGTGCAG
GGCACCTATCAGATCCTTTCCGATCAAGACTTCGGCAAGATGATCGACAACCTGCGCGTGAAGATGAACG
GTTACATGAAGCGGTACGGTCACTCGATCACGTTCGGGTTCGAGCGCGATCCCGATCGCTCGCTCGACGA
GCTGATGCGCCTCGTCGAGCCGCAGATCAACGCCGCTCGCCGCATTGGCCTCAAGTCGGAGGACATCATT
CTGGACCGCGTGCGCCGCAACGCGCCGCTCGTCGCGTGGGAACAGAACCTGATGATCGTGTACACGCACA
TGAACGTAATGAGCCCCGAAGAAATGAAGCGGGAGCTCAAGGAGCGGTCGCAGGAGGCGCAAAAGCACGG
GCTGCCGCGTATCGATTTCGGCCAAAACCCCGCGTCGGTCCTGATGGCGATGAAGTATCGCCATGACACG
ATGATCGAGCGCGTGCGACATGATTTCGAGCGCTGTGGCTCGGACGGGCGCCCTGGCATCATGCTCCGGC
CGATCAGCGCCCACGAAGCAATCAAGCGCGTGCGCATCATGGTCAATCGCGAGCGCACGTCGCAGAAATT
CCGGCCGGTGCTTCCCGGCGACCGCTTCATTCCGCGCGGGCGAGAAGACAAGCGAGATCATTCGGACCTG
ACGGCGCCCCCGGTCAATTACCAGATCTGCACGAACGATGTGACGAACCATCGCGAGCTCATCAAGACGG
ATGAACTCTGGCACGGAAACCTGTCGATGGAGCTCGGGCCGCAAGAGCCGCAGCCGTTTTCGTCGCTGTT
CGCGTCGATCGATCGCGAGATTCCGTGGCGCGTTCGCATCGATTTGAATCCGGGCGGATTGAACGAGATG
CGGGCGCGGCAAATGATGGTGGCGTTCGTCGGCATGCTGCCGAGCAACCGCCAAATTCGCCAGTCGTTCA
TCGATCTCAACGAGCGCTCGAAGGAGGACGCGATCTGCTCGATGAAGTTCGCGGTGTCCACGTGGTCGCC
GAGCGAAAGCGTGACGAAGCGCCGAATGGCCGCGCTGGAGAAGTCGATCCAGTCGTGGGGCATTTGCCAG
GTCACGTCGGTACACGGCGACCCAATGGCCGCGTGGGCGTCGACGATTCCGGGCTTCACGACAAAAAACG
TGGCCAATCGCATGGTGCCGCCGCTTCCAGACGCGCTCGCGCTGCTGCCGTTGCAGCGGCCGGCGACGCC
GTGGGGCGACGGCGGCTCGCTCATCGTGCGGACTCCCGACGGCAAAATCTATCCGATCCAGTTGGGCAGC
CGTCTGCAGGACACGTGGATCGAACTCATCAGTGCGCCACCGGGTAGCGGTAAATCGGTGCTGATGAACT
CGATGAACAGCGCGACCGTCCACCGGCCGGGCAACGTGCGGCTGCCGTTGATGACGATTATCGACGTCGG
CCCGTCGTCGTCCGGTCTGATTCAGTTGATCAAGGACTCGCTGCCCGAGCATCGCAAAAGCGAAGCGGCG
TATCTTCGCCTGCAGAACTCCCTCGAGTACGCGACCAACCCGTTCGACACGCAACTCGGCGCGCGCTTTC
CGACGTCGCGCGAGCAGGAGTTCCTGGTCGACCTGCTGACGCTGTTCTGCACGGACCCGGCGACGAAGAA
GGCGCCGTCCGGGTGCTCGCAGGTGAACGAAATGCTGTTGCGGATCGCTTATGAAGACCGCGCGACGAAA
AATCCGCACATGTATGAGCCGCATATCGACCGGACGGTCGACGCGGTGCTCGAATCGTCCGGGTTGAAGA
CGCAATACTCGGAAGAGTGGTGGTCGGTCGCGAAATGGTGGGAAGTCACCGACATGCTGTTCCAGGCCGG
CTATGTACGCGAGGCGTCGCTTGCGCAGCGCCAAGCTGTTCCGATTCTGCCGGACTTTGGTGCGTATCTG
AACGACGAATCGATCCGCGACTTGTTCGGTGAGGCCAAGGTTCCGGGCACGAACGAGCCGCTGCTCAAGT
ACATGTACCGCTGCTTCACGGTCGCGACGTCGAATTATGCTCTGTTCGCGGGCCGCACGCGCTTCGAGCT
CAACAGCGAGACTCGCATCATCTCGATCGACCTGAACGACGTCATTGGCGGCAAGACGCCCGAAGGCATG
CTTCGCACCGCGGCGATGTACATGTTCGCGCGGCAGATGGCCGCCAAAAACTACTTCCTTCGAGATGAGG
TGGTGTTGCCGGTGGTCCCGCAAATGTATCAGGAGTATCACCTGAAGCGGGTTGCGGACGTGCAGGACGA
GCAGAAGACCATCGCTTACGACGAAGTGCATAACACGGGCGGGCAAGAGGCGTTCGTGCAGACGATGATT
AAGGACGGCCGGGAAGGTCGTAAGTGGGGCATCCGCATTGTCAATGCCTCGCAATACCTGGCGGACTATC
CGACCGAGCTGCTTAACGCGGCCACGGCCGTCTATGTCATGCGTGGGGGCAACGCGGCCGACGAAGAGAT
CCTGCGTTCCGTGTACAGCGTGTCCGAGGAAGCAATCAGGCGACTGCAACGCGAAGCGGTTGGCCCCGGC
CCCGAGGGCGGCAATTTCCTCGCGCTGTTCAAGACGAAGGTGGGCTTCGTGGTGCAGCTCCTTACCAACA
CCGTCGGTCCGATCGAATTGTGGGCATTCTCGACAACGCAGGAAGACGTCGCGTTGCGCAACCGCCTCTA
TAAGCGAATCGGGCCTTACGAGGCGCGCAAGCTGCTCTCGGAGCACTTCCCGTTGGGCACCGCGCTGGAA
ACGATCGAGCACATGCGTGCCGAGTCGTCCGAGAAAGAAGACGTGTCTGTCATTGAGAGGCTGGCAAGCA
AGCTGGTCGAACGGTACACGCGCAAGATCACGAAGCAACGGGAGCTGGTCGAATGA
 Primer design