SecReT4
Protein ID: 134287818
T4SS name [ID]Tra_I [180]
Gene symbol-
Locus tagBcep1808_7576
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE04 [GenBank: NC_009228] [Browse all T4SS(s) in this replicon]
Location [Strand]24662..25435 [-]
Producthypothetical protein
Component typeTraM_I
UniProt IDA4JVZ8
KEGG IDbvi:Bcep1808_7576
PDB IDNA
Domain hit(s) vs Pfam IcmL [PF11393], Evalue: 7e-35, Aligned region: 109..215
Protein Sequence: 257 a.a.     [Download]
>gi|134287818|ref|YP_001109983.1| hypothetical protein Bcep1808_7576 [Burkholderia vietnamiensis G4]
MTALNEANQERAVAAGSLPPRDQTEPDAASPNAANEQLAEIAAELHQTADAVEPAVRMEKDRKHLQFIAG
SAVRLNFILATALLVSVVANGVLGWRAFNPDRQYFASDNGRIFPLIPMSQPYRKAADVIQYAKDTMNRSF
TMDFLNWRQQLEDVRGNYTRDGFKSFIASLQASGVLATVRDRRMNMSVTAGTGVLTKEGVENGVYVWYVE
MPIEVKLSGQTSELPAQRFLATVRIERVSTLDSIEGIGVGQLVTKPL
 
Nucleotide Sequence: 774 bp     [Download]
>gi|134287794|ref|NC_009228.1|:c25435-24662 Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence
ATGACCGCACTGAACGAAGCAAACCAGGAACGGGCCGTAGCTGCTGGCTCGCTTCCTCCGAGGGACCAGA
CTGAGCCCGATGCAGCATCCCCGAATGCGGCGAACGAGCAGCTCGCAGAGATCGCCGCCGAACTCCATCA
GACGGCCGATGCTGTCGAGCCAGCGGTACGGATGGAAAAGGATCGCAAGCACCTGCAATTCATCGCAGGC
TCGGCGGTCAGGCTGAACTTCATTCTCGCAACCGCCCTGCTCGTTAGCGTGGTTGCGAACGGTGTGCTCG
GCTGGCGTGCGTTCAACCCCGACCGTCAGTATTTCGCCTCCGACAACGGCCGCATCTTCCCGTTGATCCC
GATGTCGCAGCCGTACCGCAAAGCGGCCGATGTAATCCAGTACGCGAAGGACACGATGAATCGCTCCTTC
ACGATGGACTTCCTGAACTGGCGTCAACAGCTCGAGGACGTGCGCGGCAACTACACGCGCGACGGCTTCA
AGTCGTTTATCGCGTCGCTGCAAGCCTCTGGCGTGCTCGCGACCGTTCGCGATCGCCGAATGAACATGTC
GGTCACTGCCGGCACTGGCGTTCTCACAAAGGAGGGCGTCGAGAACGGCGTCTACGTGTGGTACGTCGAG
ATGCCGATCGAGGTCAAGCTCTCCGGGCAGACATCTGAGCTTCCCGCGCAGCGCTTCCTCGCAACGGTTC
GGATCGAGCGGGTTTCGACGCTCGACTCCATTGAAGGCATCGGCGTCGGCCAACTGGTGACGAAGCCGCT
TTGA
 Primer design