SecReT4
Protein ID: 134287880
T4SS name [ID]Tra_I [180]
Gene symbol-
Locus tagBcep1808_7643
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE04 [GenBank: NC_009228] [Browse all T4SS(s) in this replicon]
Location [Strand]84096..84584 [-]
Producthypothetical protein
Component typeTraL_I
UniProt IDA4JW60
KEGG IDbvi:Bcep1808_7643
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 162 a.a.     [Download]
>gi|134287880|ref|YP_001110045.1| hypothetical protein Bcep1808_7643 [Burkholderia vietnamiensis G4]
MKIFVRALFVLLLCSAAGVQAATCRSGSAAAAGSQSGYERDKQAAQQTAQSERSSSDILGKCVGGITSVL
TAPQFPSLSDIFDQIKNKVCQIASDQVNGVVNDVNGQISGVMNGINGQINNAVNGTGAGQVIGSVPQLSG
PSLQQTSAGSSQSSTFWSNIWK
 
Nucleotide Sequence: 489 bp     [Download]
>gi|134287794|ref|NC_009228.1|:c84584-84096 Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence
ATGAAAATCTTTGTACGCGCGTTATTCGTGCTGTTGCTGTGCTCTGCTGCCGGCGTACAGGCAGCGACCT
GCCGAAGCGGCAGCGCTGCCGCCGCGGGCAGTCAGAGCGGTTACGAACGGGATAAACAGGCTGCGCAGCA
GACTGCCCAAAGCGAACGGTCCTCCTCGGACATTCTCGGAAAATGCGTGGGCGGCATCACTTCGGTGCTG
ACCGCCCCGCAATTCCCGTCCCTCTCTGACATTTTCGACCAGATCAAGAACAAGGTCTGCCAGATCGCCA
GCGATCAGGTCAACGGCGTGGTGAACGACGTCAATGGCCAGATCAGCGGCGTTATGAACGGCATCAACGG
GCAGATCAACAATGCCGTGAACGGTACGGGCGCCGGCCAGGTCATCGGCAGCGTGCCGCAGCTCAGCGGC
CCGTCGTTGCAGCAGACCAGTGCAGGGTCGTCGCAGTCGTCGACCTTCTGGAGCAACATCTGGAAATGA
 Primer design