SecReT4
Protein ID: 134287890
T4SS name [ID]Tra_I [180]
Gene symbol-
Locus tagBcep1808_7653
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE04 [GenBank: NC_009228] [Browse all T4SS(s) in this replicon]
Location [Strand]95517..96464 [-]
Producthypothetical protein
Component typeTrbB_I
UniProt IDA4JW70
KEGG IDbvi:Bcep1808_7653
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 2.4e-11, Aligned region: 180..294
Thioredoxin [PF00085], Evalue: 5.7e-05, Aligned region: 173..212
Protein Sequence: 315 a.a.     [Download]
>gi|134287890|ref|YP_001110055.1| hypothetical protein Bcep1808_7653 [Burkholderia vietnamiensis G4]
MKSNDIIRPFEKSLFVQFGSTGELQHVSTLRLDQGVTFIRSGNTIEARYHDGAGEALVVERFSSESLATT
AFQNLQAALKRYARVRRFAGFWKAAIKWGFAPLMVAVLGLAVNMAATRAVGGSPAGGIGAAGAASMVPLP
NNLGALQQPIARPAVASPAQLAQAMADGAKSGKYAVQFSKGNKGTLYVFSDPSCPHCQDLEPELDKLAKD
YTIYIFPVTVIGGEASSHRTAKLMCAKPEARAALWKKIVQGDDLPNAECADGSDAVARNDQMFRVMRFLG
TPTIINAAGEQTPDSIPNTADAINQWMSAAATARK
 
Nucleotide Sequence: 948 bp     [Download]
>gi|134287794|ref|NC_009228.1|:c96464-95517 Burkholderia vietnamiensis G4 plasmid pBVIE04, complete sequence
GTGAAGAGCAACGACATCATTCGGCCGTTCGAGAAGTCACTATTCGTGCAATTCGGCAGCACGGGGGAGT
TGCAGCACGTCAGCACGTTGCGACTCGATCAGGGCGTTACGTTTATTCGGTCGGGCAATACGATCGAGGC
GCGGTATCACGATGGCGCCGGGGAGGCGCTGGTCGTCGAGCGCTTCTCGAGCGAATCTCTCGCGACAACC
GCGTTCCAGAACCTGCAGGCTGCGCTCAAGCGCTACGCGCGTGTACGGCGCTTCGCGGGCTTCTGGAAGG
CCGCTATCAAATGGGGCTTCGCGCCGCTGATGGTTGCCGTCCTGGGGCTGGCCGTGAACATGGCAGCAAC
GCGCGCGGTGGGTGGATCACCTGCCGGCGGCATCGGCGCCGCCGGCGCGGCATCGATGGTGCCGCTGCCG
AACAACTTGGGCGCGCTGCAACAACCGATCGCACGCCCGGCCGTCGCCTCACCTGCCCAACTGGCGCAGG
CAATGGCCGACGGCGCGAAGTCGGGCAAATACGCGGTCCAGTTTTCGAAGGGCAACAAGGGCACGCTGTA
TGTCTTCTCTGATCCGTCGTGCCCGCACTGTCAGGATCTGGAGCCCGAGCTCGACAAGCTGGCGAAGGAC
TACACCATCTACATTTTCCCCGTCACGGTGATCGGTGGTGAAGCGTCGTCGCATCGCACGGCGAAGCTCA
TGTGCGCGAAGCCCGAGGCGCGAGCTGCCCTGTGGAAGAAGATCGTTCAAGGCGACGATTTGCCGAACGC
GGAATGCGCCGACGGTAGCGATGCAGTTGCACGAAACGATCAGATGTTCCGCGTGATGCGCTTCCTTGGC
ACGCCGACGATCATCAACGCGGCAGGCGAGCAAACGCCCGATTCGATTCCGAATACGGCGGACGCGATCA
ATCAATGGATGTCGGCCGCGGCAACCGCGCGCAAGTAA
 Primer design