SecReT4
Protein ID: 134288153
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6621
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]49..678 [+]
Productsex pilus assembly and synthesis protein
Component typeTraW_F
UniProt IDA4JTB0
KEGG IDbvi:Bcep1808_6621
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 209 a.a.     [Download]
>gi|134288153|ref|YP_001110316.1| sex pilus assembly and synthesis protein [Burkholderia vietnamiensis G4]
MKLKRIIPCVVGLSLSLFASLSPAEDLGNYGNTWSIQEQDAIDMIKGRLTQMEKKGQLKKFWEDYRQKQL
SNLENPKPLPGITTATGPRVWTFDPTYTYPDNVKDHLGNILVPAGTKINPLDYTALSKSIVFIDGRDERQ
VAYAKKRIDANPRDKVVLVAGSFLKLDRAWHRPVYFDQQGILVHHFGIKRVPAVLSQKGKLLQIEEFAP
 
Nucleotide Sequence: 630 bp     [Download]
>gi|134288152|ref|NC_009230.1|:49-678 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAGTTGAAACGCATCATTCCATGCGTCGTCGGCCTTTCTCTGTCGTTGTTCGCGTCCCTGTCGCCCG
CCGAAGACCTCGGCAACTATGGCAATACCTGGAGCATCCAGGAGCAGGACGCGATCGACATGATCAAGGG
TCGTCTGACCCAGATGGAGAAGAAGGGCCAGTTGAAGAAATTCTGGGAAGACTACAGGCAGAAGCAGCTC
TCGAACCTGGAAAATCCCAAGCCGCTTCCGGGCATCACAACAGCCACCGGCCCACGTGTATGGACGTTCG
ATCCGACGTACACGTACCCGGACAACGTCAAGGACCATCTGGGCAATATCCTCGTACCCGCCGGTACGAA
GATCAATCCGCTCGACTATACGGCGCTGTCGAAGTCGATCGTGTTCATCGACGGCCGCGACGAGCGACAG
GTCGCCTATGCGAAGAAGCGGATCGACGCGAATCCCCGCGATAAAGTCGTTCTCGTCGCCGGGTCGTTCC
TGAAGCTCGACCGCGCGTGGCACAGACCGGTCTATTTCGATCAGCAAGGCATTCTCGTCCACCACTTCGG
TATCAAGCGCGTGCCGGCCGTCCTCTCCCAGAAGGGGAAACTGTTGCAGATCGAGGAGTTCGCACCGTGA
 Primer design