SecReT4
Protein ID: 134288154
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6622
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]675..1712 [+]
ProductTraU family protein
Component typeTraU_F
UniProt IDA4JTB1
KEGG IDbvi:Bcep1808_6622
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.5e-69, Aligned region: 30..338
Protein Sequence: 345 a.a.     [Download]
>gi|134288154|ref|YP_001110317.1| TraU family protein [Burkholderia vietnamiensis G4]
MKKILLAFSLVFGLFFTASSANADDLCQGKFPNLITDVCWSCVMPIKLFGSMTLLSSGQEDFDSGSGKAF
CFCQNPPKVGIPTSFWEFDMMTDVTAVPGCFPLLGGVRVSTGVNADAFGQVSDDQSGEIGETRASFMQVN
LYINPAMYVLGAILDDTCMDQRGIDIPWVSFADPTHNDDELAGIITPYAFPFGGMLAIGAMSADAVAATA
GFPLQSIFWAAGTYGHMYPLTGNNEAHMSNEQSARLQTTRILAKLHAAGTQYSAFGDDAMCGYYPQIIMD
KRQYKFTRLYPIPQTAKINGRCCDPIGRSTILTQTNTELPMPGWRDFGYAIFRKRDCCGGAIAGQ
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|134288152|ref|NC_009230.1|:675-1712 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
GTGAAGAAAATCCTTCTGGCCTTCAGTCTCGTCTTCGGCCTGTTCTTCACGGCGTCATCGGCGAACGCCG
ACGATCTCTGTCAGGGCAAATTTCCGAATCTGATCACCGATGTCTGCTGGTCCTGCGTGATGCCGATCAA
GCTGTTCGGCAGCATGACTTTGCTCTCCAGCGGGCAGGAGGACTTCGACTCAGGCAGCGGCAAGGCATTC
TGCTTCTGCCAGAACCCGCCCAAGGTCGGCATCCCCACGTCGTTCTGGGAATTCGACATGATGACCGACG
TGACTGCCGTCCCCGGCTGTTTTCCGCTGCTCGGCGGGGTACGGGTCAGCACAGGCGTGAACGCAGATGC
CTTCGGGCAGGTATCGGATGACCAGTCCGGGGAGATTGGCGAGACCCGCGCTTCGTTTATGCAGGTGAAC
CTCTACATCAATCCCGCAATGTACGTGCTCGGCGCAATCCTCGACGACACATGCATGGACCAACGCGGCA
TCGACATCCCGTGGGTATCGTTTGCCGATCCTACCCACAACGATGACGAGCTGGCCGGCATCATCACGCC
TTACGCGTTCCCATTCGGGGGGATGCTGGCTATCGGGGCGATGTCTGCGGATGCTGTGGCGGCTACCGCC
GGATTTCCGCTGCAATCGATCTTCTGGGCGGCAGGCACGTACGGGCATATGTATCCGCTCACGGGCAACA
ACGAAGCGCACATGAGCAACGAGCAGAGCGCGCGACTGCAAACCACCCGGATACTCGCCAAGCTGCACGC
GGCCGGCACCCAGTACTCGGCCTTTGGTGATGACGCGATGTGCGGCTACTACCCGCAGATCATCATGGAC
AAACGGCAATACAAGTTCACGCGCCTGTACCCCATTCCGCAGACGGCGAAGATCAACGGCCGGTGTTGCG
ATCCGATCGGACGCTCCACCATTCTTACCCAAACGAACACTGAACTGCCCATGCCGGGCTGGAGGGATTT
CGGATATGCGATTTTCCGCAAACGCGATTGTTGCGGCGGCGCTATTGCTGGCCAGTAG
 Primer design