SecReT4
Protein ID: 134288264
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6736
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]126223..127917 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA4JTM1
KEGG IDbvi:Bcep1808_6736
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 4.1e-68, Aligned region: 37..122
TraN [PF06986], Evalue: 4.1e-68, Aligned region: 153..316
TraN [PF06986], Evalue: 4.1e-68, Aligned region: 420..498
Protein Sequence: 564 a.a.     [Download]
>gi|134288264|ref|YP_001110427.1| conjugal transfer mating pair stabilization protein TraN [Burkholderia vietnamiensis G4]
MTNNRNGIWARVFFAFALCLVSAFLSLLGPQVATAAECRRTGEVCVEGGGTRNISGVDVYRDCWRYRDTY
ECKKPESIDYCAPFYAMAGCWQTSTTCVATAWDGTCLTEQRTYRCGDPSTPPPTNTIQLGNTYTITKDAL
DTKQCDPYSQNPLCTLASHTCVEGAETRVINGLPVYKDCWKWQDDYACINTTPKNDCQEYIDKGCKKLDE
TCVESTDPVGCVMKQITYSCVTKQGTTTTGEDCSARTSCYDGTCWDTGYPPDTDFATAVAGMEAGREAGV
YGAKAMDLFKGEHEECRKGYGGLKNCCKTDPGGKSNNTIMLSAGLQGAKVGSKYMFDYMYQNTEWMQSAF
SSMGFDGIDMASHFGSSFSMYGLSWTAGSTALAAGETGTGMFGQTIYGLGNGFAFDPYSFAIMVAIQIVM
SLMECNEGEQQLGMHRGSNLCHYVGDYCSKKTFGVCLQTNQSYCCYNSKLAKIINEQGKPQIGKGWGTPE
APSCDGFTAEEFQKIDFSAIDMSEFVGDIMDATDIPDIGNLQKTMSDKMKGLSTNPIGNTSGVSTGSAQT
GSTQ
 
Nucleotide Sequence: 1695 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c127917-126223 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGACAAACAACCGAAACGGCATCTGGGCACGCGTCTTTTTCGCGTTCGCCCTCTGCCTCGTTTCCGCCT
TCCTCTCGCTGCTAGGTCCGCAAGTGGCTACTGCGGCAGAATGCCGTCGCACCGGTGAAGTGTGCGTCGA
GGGTGGTGGCACGCGAAATATCTCCGGCGTGGACGTGTATCGCGATTGCTGGCGCTATCGCGATACGTAC
GAGTGCAAAAAGCCAGAATCGATCGACTACTGCGCACCTTTCTACGCGATGGCCGGCTGTTGGCAAACCT
CCACAACCTGTGTTGCGACAGCGTGGGACGGTACCTGCCTGACAGAGCAGCGCACATATCGATGCGGCGA
TCCCTCGACACCGCCGCCGACCAACACCATTCAGCTTGGCAACACGTACACGATCACGAAAGATGCACTC
GATACCAAGCAATGCGATCCGTACAGCCAGAATCCACTCTGCACCCTCGCATCCCATACATGTGTCGAAG
GCGCTGAAACGCGGGTGATCAACGGGCTCCCGGTGTACAAGGACTGCTGGAAGTGGCAGGACGACTACGC
CTGTATCAACACGACACCGAAGAACGATTGCCAGGAGTACATCGACAAAGGTTGCAAGAAACTCGACGAA
ACCTGTGTTGAGAGCACCGATCCTGTCGGCTGCGTGATGAAGCAAATTACCTATAGCTGTGTCACCAAAC
AGGGCACGACGACCACCGGCGAAGATTGCAGTGCGCGTACATCCTGCTATGACGGCACTTGCTGGGACAC
TGGCTATCCGCCCGACACGGATTTCGCGACGGCGGTAGCCGGTATGGAAGCGGGCCGCGAAGCCGGTGTC
TACGGCGCGAAGGCTATGGACCTGTTCAAGGGCGAACACGAAGAATGCCGCAAGGGCTATGGTGGCCTGA
AGAACTGCTGCAAAACTGATCCGGGAGGCAAAAGCAACAACACCATCATGCTGTCGGCTGGTCTACAAGG
CGCGAAAGTGGGCTCGAAGTACATGTTCGACTACATGTATCAGAACACTGAGTGGATGCAATCCGCATTC
AGTTCGATGGGTTTTGACGGCATCGACATGGCGTCGCACTTTGGCTCGTCGTTCTCGATGTACGGCCTGT
CGTGGACGGCTGGATCGACTGCCCTTGCTGCCGGCGAGACCGGGACAGGCATGTTCGGGCAGACCATCTA
CGGTCTCGGCAACGGCTTTGCTTTCGACCCGTACTCCTTCGCAATCATGGTCGCCATCCAGATTGTCATG
TCGCTGATGGAGTGCAATGAAGGCGAGCAGCAGCTCGGCATGCATCGCGGCTCGAATCTTTGCCACTATG
TCGGCGACTACTGCTCGAAAAAGACCTTTGGTGTCTGCCTGCAAACCAACCAGTCGTACTGCTGCTACAA
CTCGAAGCTGGCCAAGATCATCAACGAGCAAGGCAAGCCGCAGATCGGCAAGGGTTGGGGAACGCCTGAA
GCGCCGAGCTGCGATGGGTTCACGGCGGAAGAGTTCCAGAAGATCGACTTTTCGGCGATCGACATGAGCG
AGTTCGTCGGCGACATCATGGATGCAACGGACATTCCGGACATCGGGAACCTCCAGAAGACCATGTCCGA
CAAAATGAAGGGGCTGTCGACCAATCCGATTGGTAACACCTCTGGCGTGTCGACTGGCTCCGCGCAGACC
GGCTCAACTCAGTAA
 Primer design

Protein ID: 134288265
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6737
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]127943..129166 [-]
Producthypothetical protein
Component typeTraN_F
UniProt IDA4JTM2
KEGG IDbvi:Bcep1808_6737
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 407 a.a.     [Download]
>gi|134288265|ref|YP_001110428.1| hypothetical protein Bcep1808_6737 [Burkholderia vietnamiensis G4]
MRRFLLLGALSCALALQSGLALADAHSDGLSYGKGQLDKLNGNITNNNAKNVPFYTTTPSQSSSFGGPSL
FDVGVSRITSCKTATHGSDAVANQECDAVNFLAKNPDNRVKVPIGNDDPIIKGIGDTINNANGHYNDNGC
VPATTTTPDQHSTEVCNEYLVTDDKLCNMGQVVEVDADSNYQCNVTKNSLYTQQCDKVLNVWCQPGQDGC
DNGGIVPGSTQGDMRVWLGPIGGGTWDLQFGTFADNYWAGDKTNGAVYDRSLSFNIRDITQLTQFTLVRA
AFDDWLWVQVNGITVYVGPYGGDRLYQVQTSYQASCGGKDSGMCTYYHTQIQYGPNSFGNAELGSSWNMG
LNIDLRPFLHNGDNTIWTRTIVAGNGESALDIYARMYCPAVCYDSWDNQCQNLESRS
 
Nucleotide Sequence: 1224 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c129166-127943 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAGACGATTTCTACTACTCGGCGCTCTTAGCTGCGCTTTGGCCTTGCAAAGCGGCCTCGCGCTTGCTG
ACGCGCACTCAGACGGGCTCAGCTATGGCAAAGGTCAGCTCGACAAGCTGAACGGCAATATCACGAACAA
CAACGCCAAGAACGTACCGTTCTATACAACGACGCCGAGCCAGAGCTCAAGCTTCGGTGGCCCGTCGCTC
TTCGACGTGGGCGTGAGCCGGATCACGTCGTGCAAGACAGCGACCCACGGAAGTGACGCCGTCGCCAACC
AGGAGTGCGACGCTGTCAATTTTCTCGCCAAGAACCCGGATAACCGGGTCAAGGTGCCGATCGGCAACGA
CGATCCGATTATCAAGGGCATTGGCGACACCATCAACAACGCGAACGGCCACTACAACGACAACGGCTGC
GTGCCGGCGACGACCACGACGCCCGATCAGCACTCGACCGAAGTTTGCAATGAGTATCTGGTCACGGACG
ACAAGTTGTGCAACATGGGCCAGGTCGTCGAGGTCGACGCGGACAGTAACTACCAGTGCAACGTCACGAA
GAACAGCCTTTACACGCAGCAGTGCGACAAAGTGCTCAACGTCTGGTGTCAGCCTGGGCAGGACGGTTGC
GATAACGGCGGTATCGTTCCCGGGTCAACGCAGGGCGACATGCGCGTCTGGCTGGGTCCGATCGGCGGAG
GCACATGGGATCTTCAGTTCGGCACCTTCGCGGACAACTACTGGGCCGGTGACAAGACGAACGGCGCGGT
CTACGACCGTTCGCTCAGCTTCAACATCCGCGATATCACCCAACTCACCCAGTTCACCCTTGTCAGGGCG
GCATTCGACGACTGGCTGTGGGTACAGGTCAACGGCATTACGGTCTATGTCGGCCCATACGGCGGGGACC
GGCTCTATCAGGTCCAAACCTCGTATCAGGCAAGCTGCGGCGGCAAGGATTCGGGGATGTGTACCTACTA
CCACACCCAGATCCAGTATGGCCCTAACTCCTTCGGCAACGCCGAGTTGGGTAGCAGTTGGAACATGGGT
TTGAACATTGACCTGCGACCGTTCCTGCACAACGGCGACAACACCATCTGGACGCGCACGATCGTCGCCG
GCAACGGCGAAAGCGCACTCGACATTTACGCGCGCATGTATTGCCCAGCCGTTTGCTACGACAGTTGGGA
TAACCAGTGCCAAAACCTCGAGTCGCGATCGTGA
 Primer design