SecReT4
Protein ID: 134288273
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6745
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]136279..136722 [+]
Productlytic transglycosylase, catalytic
Component typeOrf169_F
UniProt IDA4JTN0
KEGG IDbvi:Bcep1808_6745
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 147 a.a.     [Download]
>gi|134288273|ref|YP_001110436.1| lytic transglycosylase, catalytic [Burkholderia vietnamiensis G4]
MKKLLTTLLFAVLAVASTHAWAFCFKEAADRYQVDERLLRAIARTENAAYDPRLVIRDKDGWEYIGLMMI
STIWLPELKKYGIDRERLMDPCINVNVGAWVLRDAQVRYGATWKSVGAFNTGKYSDDTAAQRRYITKVWR
NFNKENR
 
Nucleotide Sequence: 444 bp     [Download]
>gi|134288152|ref|NC_009230.1|:136279-136722 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAAAAGCTACTGACCACGTTACTGTTCGCTGTACTCGCGGTCGCGAGCACGCACGCATGGGCTTTCT
GTTTCAAGGAAGCTGCGGACCGATATCAGGTCGACGAACGCCTGCTGCGTGCGATTGCCAGAACAGAAAA
CGCCGCGTACGACCCTCGGTTGGTGATCAGGGACAAGGACGGATGGGAGTACATCGGCCTGATGATGATC
AGCACGATCTGGCTGCCAGAACTGAAGAAATACGGGATTGATCGCGAGAGGCTGATGGACCCGTGCATCA
ACGTCAATGTAGGTGCGTGGGTGCTTCGCGATGCTCAAGTTCGATATGGCGCTACGTGGAAGTCGGTGGG
CGCCTTCAACACCGGGAAGTATTCGGACGATACAGCCGCACAACGACGGTACATCACCAAGGTTTGGCGG
AATTTCAACAAGGAGAATAGATGA
 Primer design