SecReT4
Protein ID: 134288277
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6749
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]139337..142888 [-]
Producthypothetical protein
Component typeTraG_F
UniProt IDA4JTN4
KEGG IDbvi:Bcep1808_6749
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.4e-62, Aligned region: 5..484
Protein Sequence: 1183 a.a.     [Download]
>gi|134288277|ref|YP_001110440.1| hypothetical protein Bcep1808_6749 [Burkholderia vietnamiensis G4]
MPSFNIYVLGDVSSFYATLNAVAMIFAQKGFLNSAFMVGGLVMLISGILYMIGKQSDGSVPGVMGPISGM
FGLFAVVWTSTIPTSVMINDIYTGNVAKVDNVPLIISVPASAFTTASNRIFQLANTAFQATSGSYMAVGE
QGFMMPLKILFSLRGGFDNADANLDASLRSFILDCIPNSDTFSMDALKQSANSVDYILQNGRPNGLTTYW
PSADAAGNPSPTPQAQSVSCSQAKALIDTDVFGKFFSGSNKNLMNLMNQNMKDKNPHGSSYTQDDAANAW
AGLIPATWQAAQSATTFMSNALTYNTITNTFNCMGANGSQASYDMCNVQMTQAFEQSRTDAAAAGSFFSK
MMMPAMIFMQLMFFGFAPLVVIYGVMKGGGALGMYVKYLLFGIWTSSWLPFAAVIQMYIQNDVLSKFAEI
KSNGLTLGNFSPIYYDLLASRLSVASDMLAATPLVSLAMLTGSAMAVTSLAGRWSGRDHVDERQSSPDLL
KNGGLVDVGAAAKYGPSQTGDRLSGSLRTDASLPSFRMGEATDNSVSSASAQVASSRAEAAQSFERLLNQ
MKSHSTGSKVSDSDISGIAKDYSSRASQVHEQANAMMDRLGFSQEQKSSVQAGVEASGGFSSPFGGVKVT
AQAIANASKGKVSAEEVQSSMSSKIGTDESWATSITNKAQHAVDHYVGDDNKTAQGLAASARESIGRVQQ
AEQSFQRATSLKNSVGADFSVQGSELGAKILANPAAKAELDKDHAEHLNDSGYHARYEAARGQVARAGDI
RGGEELARFMALAGHKGGMVGAATVLSMLSGVSAPKDFDANANQNVGAAANAVPADPSRGALSLRDPHVL
AHSAPSPSGGASAPGSGPTATGGGSGPAARQQANHRVAPSVLTASATPSAPTRAAAPSAPTAGGGSPANM
NDLQSRVNALAANSIPDFDAHRAELGAKTGGVDQAIADQRADLGASVPVLSAEQVQDVFHREVGTVQNAL
AGAGMAYGDFEQAHPVLAAGIEIGMTMIPAVRLASGGMKVLKLSRVAQEGWKGVEAAKAGVSAALKEKTA
MEAAFTSKNGALLGGGRTLDARRVADMGFKSTDEFLDAYAKAGKNVIGAEKHLAETATDYTKKFGASLGE
GGLPKDATIGFVAKNASSQVASAGKSAGGAAWLSMSKYEANVHQQELEHEKEVRDLRKGVRGR
 
Nucleotide Sequence: 3552 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c142888-139337 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGCCGAGCTTCAATATCTACGTCTTGGGGGACGTTAGCTCCTTCTACGCGACGCTGAATGCCGTCGCCA
TGATTTTCGCTCAGAAGGGCTTTCTGAATAGTGCGTTCATGGTCGGCGGTCTCGTGATGCTGATCTCCGG
CATCCTGTACATGATCGGGAAACAGAGTGATGGATCTGTGCCCGGCGTTATGGGGCCGATTAGCGGGATG
TTCGGGCTGTTCGCTGTCGTTTGGACTTCGACCATCCCGACTTCCGTCATGATCAACGACATTTACACCG
GCAACGTTGCCAAGGTGGACAACGTGCCATTGATCATTTCGGTGCCAGCGAGCGCATTCACCACTGCGAG
TAACCGGATATTCCAGTTGGCTAACACCGCGTTCCAAGCTACGAGCGGAAGCTACATGGCCGTCGGTGAG
CAGGGCTTCATGATGCCCCTCAAGATTCTCTTCTCACTGCGAGGAGGCTTCGACAACGCCGATGCGAATC
TCGACGCGAGCCTGCGATCGTTCATCCTGGACTGCATCCCGAATTCCGACACTTTCTCCATGGATGCACT
GAAGCAATCGGCCAACTCGGTCGACTACATCCTTCAGAACGGGCGCCCCAACGGACTGACCACGTATTGG
CCGTCCGCTGATGCCGCTGGCAATCCTTCGCCGACACCACAGGCGCAATCGGTGTCTTGCAGTCAGGCAA
AGGCATTGATCGATACAGACGTGTTCGGCAAGTTCTTCTCAGGCTCGAACAAGAACCTGATGAACCTGAT
GAACCAGAACATGAAGGACAAGAATCCGCACGGTTCGTCCTATACACAGGACGATGCAGCGAACGCGTGG
GCGGGCCTCATTCCCGCAACGTGGCAGGCTGCCCAGTCCGCCACGACCTTTATGTCCAACGCACTGACGT
ACAACACGATTACCAATACGTTCAACTGCATGGGAGCGAACGGGTCCCAGGCGAGCTATGACATGTGCAA
CGTGCAGATGACGCAGGCGTTCGAGCAGAGTCGTACCGACGCTGCTGCGGCCGGCTCGTTCTTCTCGAAG
ATGATGATGCCTGCAATGATCTTCATGCAGCTCATGTTCTTCGGGTTTGCGCCCTTGGTTGTCATTTACG
GCGTAATGAAGGGCGGTGGTGCGCTCGGGATGTATGTGAAGTACCTCTTGTTCGGTATCTGGACCTCGAG
CTGGCTCCCGTTCGCCGCTGTCATCCAGATGTACATCCAGAATGACGTTCTCAGCAAATTCGCCGAGATC
AAGTCGAACGGTCTGACGCTCGGCAACTTCTCACCGATCTACTACGATCTGCTGGCCTCCCGCCTATCGG
TGGCGTCAGATATGCTTGCTGCCACGCCGCTTGTGTCATTGGCGATGCTCACCGGTTCGGCGATGGCAGT
CACGTCTCTCGCCGGTCGCTGGTCTGGGCGTGACCACGTCGACGAGAGGCAATCGAGCCCTGATCTGCTG
AAGAATGGCGGGCTCGTCGACGTAGGCGCGGCGGCCAAGTACGGCCCTTCTCAAACTGGGGATCGACTGT
CGGGCTCGCTGCGCACCGACGCATCGCTTCCGAGCTTCCGGATGGGTGAAGCGACGGACAACAGCGTCTC
TAGCGCATCAGCGCAGGTTGCGTCGAGTCGTGCAGAAGCCGCACAAAGCTTCGAGCGGCTGTTGAATCAG
ATGAAATCCCACTCCACGGGCTCCAAGGTGTCGGATTCCGACATCAGCGGCATCGCCAAGGATTATTCGA
GCCGCGCAAGTCAGGTCCACGAGCAGGCAAACGCGATGATGGACCGGCTTGGCTTCAGCCAGGAGCAGAA
GTCGTCCGTGCAAGCGGGGGTGGAGGCTTCCGGCGGCTTTAGTAGCCCATTTGGCGGCGTAAAAGTAACT
GCACAAGCTATCGCCAACGCAAGCAAGGGCAAAGTGAGCGCTGAGGAGGTTCAGAGCTCGATGTCCTCCA
AGATCGGGACAGATGAAAGCTGGGCGACCAGCATTACCAACAAGGCGCAGCACGCGGTTGATCACTATGT
CGGCGACGACAACAAGACTGCCCAAGGTCTGGCTGCGTCTGCTCGCGAGTCCATTGGGCGCGTCCAGCAA
GCCGAGCAGAGCTTCCAGCGAGCCACCAGCCTGAAAAACTCCGTCGGAGCCGATTTCTCGGTTCAAGGAT
CGGAGCTGGGCGCGAAAATTCTCGCGAACCCGGCCGCGAAGGCAGAGCTGGACAAGGATCACGCTGAACA
CCTGAACGACAGCGGATATCACGCACGCTATGAGGCCGCGAGGGGGCAGGTCGCGCGTGCAGGTGACATT
CGCGGAGGCGAGGAACTTGCCCGCTTCATGGCGCTCGCGGGCCATAAGGGCGGCATGGTTGGTGCGGCGA
CGGTGCTCTCGATGTTGAGTGGCGTCAGCGCTCCGAAAGACTTCGATGCTAACGCGAACCAAAATGTCGG
GGCAGCCGCGAACGCGGTCCCCGCGGACCCGTCACGCGGAGCACTCAGTCTGCGCGATCCTCACGTGCTT
GCTCACAGCGCCCCATCGCCCTCGGGCGGAGCGTCGGCACCGGGTAGTGGTCCGACCGCAACAGGCGGCG
GTAGCGGCCCGGCAGCCCGGCAACAAGCGAATCATCGGGTGGCGCCGTCCGTTCTCACTGCATCCGCAAC
CCCGTCTGCGCCGACCCGCGCCGCTGCACCGAGTGCACCGACTGCGGGCGGCGGCAGCCCTGCCAACATG
AACGACCTTCAGTCTCGGGTGAACGCGCTTGCGGCGAACTCGATCCCCGATTTCGACGCACATCGGGCCG
AGCTCGGCGCAAAGACCGGTGGCGTGGACCAGGCGATTGCGGATCAGCGTGCTGATCTTGGGGCATCGGT
TCCGGTGCTCTCGGCTGAGCAAGTGCAGGACGTGTTCCATCGCGAAGTGGGAACCGTACAGAATGCGCTT
GCCGGTGCCGGAATGGCGTATGGGGACTTTGAGCAGGCGCATCCAGTACTTGCGGCTGGGATCGAGATCG
GTATGACGATGATTCCGGCGGTACGTCTCGCAAGCGGCGGCATGAAGGTGCTGAAGTTGTCTCGCGTCGC
GCAAGAAGGCTGGAAGGGTGTCGAAGCTGCTAAAGCGGGGGTGTCGGCCGCACTGAAGGAGAAGACAGCG
ATGGAGGCAGCCTTCACCTCCAAGAATGGCGCATTGCTGGGCGGGGGACGGACGCTTGACGCTCGGCGAG
TTGCTGATATGGGCTTCAAGAGCACTGACGAATTCCTTGACGCATACGCGAAGGCTGGCAAGAACGTCAT
CGGCGCCGAGAAACACCTGGCGGAAACGGCCACCGATTACACGAAAAAATTCGGTGCTAGCCTCGGCGAA
GGTGGGCTGCCCAAAGATGCCACCATCGGCTTCGTTGCCAAGAACGCATCTTCACAGGTTGCGTCTGCCG
GGAAATCCGCCGGCGGAGCGGCATGGCTGTCGATGTCCAAGTACGAGGCGAACGTGCATCAACAGGAGCT
CGAGCACGAGAAGGAAGTGCGCGACCTTCGGAAGGGTGTGCGCGGCCGATAG
 Primer design