SecReT4
Protein ID: 134288278
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6750
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]142901..144352 [-]
ProductTraH family protein
Component typeTraH_F
UniProt IDA4JTN5
KEGG IDbvi:Bcep1808_6750
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.7e-95, Aligned region: 28..413
Protein Sequence: 483 a.a.     [Download]
>gi|134288278|ref|YP_001110441.1| TraH family protein [Burkholderia vietnamiensis G4]
MKMRFKRVILLMSLVCSVGMSSTANAGLQDALDGMFMSNSTTPDSFTNQSRGGLVGGGASVRMPIRNINL
ISFDPPRLSAGCGGIDLFGGSFSFINADQLVALFRQIAANAVGVAFKAAIDAINPALGKLMQDFQNKIAA
LNSMMKNTCALATTIMDKTGVSGAIRSFVDENVSSETGSKSGMLTDMFSGIDSFLSNANTVTRNVQKSGK
EPELGNLTWMALNTTQAGQMLGNPQTGETDANGANEIVMSLIGTVVNGPENSSDTTASDGSVAVDNGRYW
APTIRLLDLKDGNMSGNKPMYALRCADGYDLNKCMKISKQNLSFGGVSGYVNLMLFGDAAGRSISTDSIV
GKLVSCSGNACDFTSAQKTFIGNISAPVLGLMKKVQSMPGAAAQMAVLTAPIVTDELTLKYAESALVAAQ
AAFSGTTYTKDEKISSAERDLLNEVIQLRTSSSADFEKLNAAIAYSKAISENNPAVFVKPPIK
 
Nucleotide Sequence: 1452 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c144352-142901 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAAATGAGATTCAAGCGAGTCATCCTCCTGATGTCGCTCGTTTGCAGCGTGGGGATGTCCTCGACGG
CAAACGCTGGGCTTCAAGACGCCCTCGACGGCATGTTTATGTCGAACTCGACCACGCCGGACAGCTTTAC
TAACCAGTCGCGCGGGGGACTGGTCGGGGGTGGCGCGTCGGTACGCATGCCTATCCGGAACATCAACCTG
ATCTCTTTTGATCCGCCACGACTGTCGGCCGGTTGCGGCGGGATCGACCTCTTCGGGGGTTCTTTCTCGT
TTATCAACGCTGACCAGCTCGTCGCGCTGTTCCGCCAGATTGCCGCCAATGCGGTTGGCGTCGCGTTCAA
GGCAGCGATTGACGCGATCAACCCGGCACTCGGCAAGTTGATGCAGGACTTCCAGAACAAGATCGCCGCG
TTGAACTCCATGATGAAAAACACGTGCGCGCTCGCGACTACGATCATGGACAAGACCGGCGTCAGTGGCG
CGATTCGGTCATTTGTCGACGAGAACGTGTCGTCCGAGACGGGATCGAAGTCCGGCATGCTCACCGACAT
GTTCTCTGGTATCGATTCGTTCCTGTCCAACGCGAACACAGTCACGCGAAACGTCCAGAAGTCCGGCAAA
GAGCCCGAGCTCGGCAACCTGACGTGGATGGCCCTGAACACCACGCAAGCGGGACAGATGCTCGGTAACC
CCCAGACCGGCGAGACCGATGCCAACGGCGCCAACGAGATTGTCATGAGCCTGATCGGCACTGTCGTGAA
CGGCCCGGAGAACAGTTCTGACACTACGGCATCAGATGGCAGCGTCGCCGTCGACAATGGCCGCTACTGG
GCGCCGACCATCCGCCTTTTGGACCTCAAAGACGGCAACATGAGCGGCAACAAGCCCATGTATGCGCTGC
GATGCGCTGATGGATACGACCTCAACAAGTGCATGAAGATCTCAAAGCAGAACCTGTCGTTCGGCGGTGT
AAGTGGCTACGTCAATCTGATGCTGTTTGGCGATGCAGCCGGCCGGTCCATCTCGACTGATTCGATCGTC
GGCAAGCTGGTTTCGTGCTCGGGCAACGCTTGTGACTTTACGTCCGCGCAGAAGACGTTCATCGGCAACA
TCAGCGCCCCCGTGCTGGGGCTGATGAAGAAAGTGCAGTCGATGCCCGGCGCCGCTGCGCAGATGGCCGT
GCTCACAGCGCCGATCGTGACCGACGAGCTCACACTCAAATATGCGGAGTCAGCACTTGTCGCTGCGCAA
GCCGCGTTCAGCGGTACGACATACACGAAGGACGAGAAGATTTCCTCTGCCGAGCGGGACCTCTTGAACG
AGGTTATTCAGCTCCGCACGAGTTCCTCGGCCGACTTCGAAAAATTGAACGCAGCGATCGCCTACTCGAA
GGCAATCAGTGAAAACAACCCGGCTGTCTTCGTGAAGCCGCCGATCAAATAA
 Primer design