SecReT4
Protein ID: 134288279
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6751
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]144369..145316 [-]
Productsex pilus assembly protein
Component typeTraF_F
UniProt IDA4JTN6
KEGG IDbvi:Bcep1808_6751
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.5e-76, Aligned region: 38..262
Thioredoxin_2 [PF13098], Evalue: 5.3e-05, Aligned region: 173..260
Protein Sequence: 315 a.a.     [Download]
>gi|134288279|ref|YP_001110442.1| sex pilus assembly protein [Burkholderia vietnamiensis G4]
MKLNKFVSLLLLGSLALPLFAQEPTDQSGRFLERKSEGWFWYKDPKDEVKKEVPPPPPPPPSPEVDAKQQ
PAEKPDQPFSVEWLRKNMPRFLDAAINNPTKENVETYLYAQRVAMDKSQRYAEMTQRVVAADPFLDENNR
VPIAAYTKSFFLRQFNAGNAEALKHIAKVGGLWVFFDSKCEYCRPQANSVQEITKKYGFVTKFISMDGKG
LPNVTEFVKDKGQAKLLNLRLTPTTVLVVPPNNYFIVSQGMMAQDQLEQRIVLAADSNNLLPPDIAKKIR
TYDRGVLSNDDMQKGATKDPKEWVKYLKDRLEGRY
 
Nucleotide Sequence: 948 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c145316-144369 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAATTAAATAAATTTGTATCGCTTCTGCTGCTCGGATCGCTGGCACTGCCGCTGTTCGCCCAGGAGC
CCACAGACCAGTCAGGCCGATTCCTTGAGCGCAAGTCAGAAGGGTGGTTTTGGTACAAAGACCCCAAAGA
CGAGGTAAAAAAGGAGGTCCCACCGCCTCCGCCGCCCCCTCCTTCTCCGGAGGTTGATGCCAAGCAGCAA
CCCGCCGAGAAGCCGGATCAGCCTTTTTCAGTCGAATGGCTGCGCAAAAACATGCCGAGGTTTCTCGATG
CTGCCATCAACAATCCGACCAAGGAAAACGTAGAAACCTATCTCTACGCCCAGCGTGTCGCGATGGACAA
GTCGCAGCGCTACGCGGAGATGACGCAGCGTGTCGTGGCCGCCGACCCGTTTCTTGACGAAAACAACCGC
GTGCCTATCGCGGCCTATACGAAATCGTTCTTCCTGCGTCAGTTTAATGCGGGCAACGCTGAGGCACTCA
AGCACATCGCGAAGGTCGGCGGGTTGTGGGTCTTTTTCGATTCGAAATGTGAGTATTGCCGACCGCAGGC
AAACAGTGTCCAAGAGATCACCAAGAAGTATGGCTTCGTAACGAAGTTCATCTCGATGGACGGCAAAGGA
CTGCCCAACGTAACCGAGTTCGTGAAGGACAAGGGCCAAGCAAAGCTTTTGAACTTGCGCCTCACACCAA
CGACGGTTCTCGTGGTTCCCCCGAACAACTACTTCATTGTTTCGCAGGGAATGATGGCGCAGGATCAGCT
CGAACAGCGGATCGTTCTCGCTGCCGACTCCAACAACCTGTTGCCACCGGATATCGCAAAGAAGATTCGC
ACCTACGATCGCGGCGTGCTTTCAAACGACGACATGCAGAAGGGTGCAACCAAAGATCCGAAGGAATGGG
TGAAGTATCTGAAAGACCGCCTCGAAGGGCGTTACTAA
 Primer design