SecReT4
Protein ID: 134288282
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6754
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]146598..149057 [-]
Productsex pilus assembly protein
Component typeTraC_F
UniProt IDA4JTN9
KEGG IDbvi:Bcep1808_6754
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 8e-55, Aligned region: 451..723
TraC_F_IV [PF11130], Evalue: 1.7e-50, Aligned region: 22..254
Protein Sequence: 819 a.a.     [Download]
>gi|134288282|ref|YP_001110445.1| sex pilus assembly protein [Burkholderia vietnamiensis G4]
MLGFFRSKGSNASPVIEGSREDLPYKKVTVQACDPESKVFLASDGSEHYLGACFVADPLKGADDSTVDKF
RSALSMPFPPGTFVQIGLLASPDADDYLDAYLEGKYHDNEVLRALALQHASLVRRGKDQALVTRSGVLLN
RQRLVITIKTPCARALPTDGDIAAARETADRVQEAFKAAELETLQLDAEGYLVLLRLLTKLWDHPSHHYD
ETRPINEQVYFPGDAVNYDDPTTIKFNDGAHYAKVMSVKYFPKRASLAIMNHMIGDPLGLSNQITDPYYM
VLTLHYPDQVKKVDWVKGRSSMLNHQVFGPTAHMIPALGYKKHGMDVLIHDIEGKGSIVCEANFTLFLFS
RSREKLNKLVAGLQAYYTSLAFEIREDRRILEPLWNNLLPLNTSREGIKNLFRFHTMGISHAVQFMPVIG
EWTGSGRSGALLLVTRRGQPALIDLYESATNYNGVVFAEAGAGKSFLTQKIVSDYLAEGAKVWAIDAGRS
YFKLCKAVKGTFVEFKQDSDLCLNPFTFIENLEEEMDILKAMLAKMAAPDETLDAYPMSRLEEAITSVYT
KYGKNATVKAVAEFCLAQPDEDTQRLGKQLFPFAGGAYTRWFEGDNNLDMDNAFVVLELSDLKGRKALQQ
VVLLQLMSRINYDMFLTRGRKKILIIDEAWELLDDPLMGKAMEALYRKARKEEGAVLIVTQSIEDLYNSP
NARAIAANSAWQFILKQNSESIDGAIAGGQFKIEPYGAAMLKTVHTVPGKYSEVMVKRSESEWGIFRLTV
DRFTQVLFSTKNDERNAIFDAIDRGDSVVDAVHQFIDRENSEKAELEAA
 
Nucleotide Sequence: 2460 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c149057-146598 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGCTCGGCTTTTTTAGATCGAAGGGTTCAAACGCCTCGCCGGTAATCGAGGGAAGCCGGGAGGACCTCC
CTTACAAGAAGGTCACCGTTCAGGCGTGCGATCCGGAAAGCAAGGTGTTTCTCGCCTCTGACGGTAGCGA
ACACTACCTGGGGGCTTGTTTTGTCGCGGACCCCCTCAAGGGTGCTGACGACTCCACCGTCGACAAGTTT
CGCTCGGCACTGAGCATGCCGTTTCCGCCCGGGACGTTCGTGCAGATCGGTTTGCTCGCTTCACCCGACG
CCGATGACTATCTTGATGCCTACCTCGAAGGCAAGTACCACGACAACGAAGTGCTCCGTGCGCTCGCGTT
GCAACACGCGTCACTGGTCCGCAGAGGCAAGGATCAGGCGCTCGTAACTCGTAGCGGCGTCCTGTTGAAT
CGCCAGCGTCTCGTCATCACGATCAAGACGCCCTGCGCTCGCGCCTTGCCTACCGATGGCGATATTGCCG
CGGCACGCGAGACCGCGGATCGTGTTCAGGAAGCGTTCAAGGCCGCGGAACTCGAGACCTTGCAACTCGA
CGCGGAGGGCTATCTCGTTCTCCTGCGTCTCCTTACGAAGTTGTGGGATCACCCGAGCCACCACTACGAC
GAAACGCGACCGATCAACGAACAGGTGTACTTCCCCGGTGACGCGGTCAACTACGACGACCCGACCACCA
TCAAATTCAACGACGGCGCTCACTACGCGAAAGTGATGAGCGTCAAGTACTTCCCCAAGCGGGCCAGTCT
GGCGATCATGAACCATATGATCGGCGACCCGTTGGGACTGTCGAATCAGATCACCGATCCGTATTACATG
GTCCTCACGCTCCACTATCCGGATCAGGTGAAGAAGGTCGACTGGGTCAAGGGCCGCTCATCGATGCTGA
ATCATCAGGTGTTCGGACCCACGGCCCACATGATTCCCGCCTTGGGATACAAAAAGCACGGGATGGACGT
GCTGATCCACGATATTGAAGGGAAGGGCTCGATCGTTTGTGAAGCCAACTTTACGTTGTTCCTTTTCTCG
CGTAGTCGAGAGAAGCTGAACAAACTGGTTGCAGGCCTCCAGGCTTACTACACTTCGCTCGCGTTCGAAA
TCCGCGAGGATCGGCGCATCCTTGAACCTCTTTGGAACAATCTGCTGCCGCTAAACACGTCCCGGGAAGG
GATCAAGAATCTGTTCCGCTTCCACACGATGGGCATTTCGCACGCTGTCCAGTTCATGCCCGTGATCGGC
GAATGGACCGGTAGCGGGCGAAGCGGTGCACTCTTACTGGTGACGCGTCGCGGTCAGCCAGCGCTCATCG
ACCTGTACGAATCGGCCACGAACTACAACGGGGTCGTATTCGCCGAAGCAGGCGCCGGCAAGAGCTTCTT
GACGCAAAAAATCGTCAGCGACTATCTCGCCGAAGGCGCGAAGGTATGGGCGATCGATGCAGGGCGTTCG
TACTTCAAGCTGTGCAAGGCAGTAAAGGGGACGTTCGTTGAGTTCAAGCAGGATTCCGATCTCTGCCTGA
ACCCGTTCACGTTCATCGAAAACCTCGAGGAAGAGATGGACATCCTCAAGGCGATGCTCGCGAAGATGGC
GGCCCCTGACGAGACACTCGACGCGTATCCGATGTCGCGCCTTGAGGAGGCGATCACCAGCGTCTATACC
AAGTACGGCAAGAATGCGACAGTTAAAGCTGTCGCCGAGTTCTGTCTCGCCCAGCCCGACGAAGACACTC
AGCGCCTCGGGAAGCAACTGTTCCCGTTTGCTGGCGGCGCCTACACGCGATGGTTCGAGGGCGACAACAA
CCTGGACATGGACAACGCGTTCGTGGTCCTCGAGCTCAGCGATCTGAAGGGCCGTAAGGCCCTGCAACAG
GTCGTGCTGCTCCAGTTGATGTCGCGGATCAACTACGACATGTTCCTGACGCGCGGCCGTAAGAAGATCC
TGATCATAGATGAGGCCTGGGAACTCCTGGACGATCCGTTGATGGGAAAAGCCATGGAAGCCCTCTACCG
TAAAGCTCGGAAAGAAGAGGGTGCGGTTCTTATCGTTACACAATCGATTGAGGATCTCTACAACTCGCCC
AATGCTCGCGCAATTGCAGCCAACTCGGCGTGGCAGTTCATCCTGAAGCAAAACAGCGAATCGATTGACG
GCGCTATCGCTGGTGGGCAGTTCAAGATCGAGCCGTACGGAGCGGCAATGCTGAAGACCGTGCATACCGT
GCCGGGCAAGTACTCCGAAGTGATGGTCAAGCGAAGCGAGAGTGAGTGGGGAATCTTCAGGCTTACTGTC
GACCGCTTCACGCAGGTGCTGTTCTCAACGAAGAACGACGAGCGGAATGCCATCTTCGACGCAATCGACC
GTGGTGACAGCGTCGTAGACGCCGTCCACCAGTTTATCGACCGAGAAAACTCAGAGAAGGCCGAGTTGGA
AGCGGCATAG
 Primer design