SecReT4
Protein ID: 134288283
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6755
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]149192..149479 [-]
Producthypothetical protein
Component typeTraA_F
UniProt IDA4JTP0
KEGG IDbvi:Bcep1808_6755
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 95 a.a.     [Download]
>gi|134288283|ref|YP_001110446.1| hypothetical protein Bcep1808_6755 [Burkholderia vietnamiensis G4]
MKRNKQALLTLALFAVALALDASAASDGTFSEIVDRLTGWMTGSLGTTFALGSLAVGLAMGVVKQSVMSV
VTGVAVALSASLGPNVLQGLFTATL
 
Nucleotide Sequence: 288 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c149479-149192 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAGCGTAACAAGCAAGCTCTGCTGACCCTCGCACTGTTCGCCGTTGCTCTCGCACTCGACGCGTCGG
CGGCCAGCGACGGCACTTTCAGCGAAATCGTCGACCGCCTGACCGGCTGGATGACCGGGTCGCTGGGCAC
GACCTTCGCACTCGGTTCGCTGGCAGTCGGTCTGGCGATGGGCGTCGTCAAGCAGTCCGTGATGAGCGTC
GTGACGGGCGTGGCCGTCGCACTGAGCGCGTCGCTCGGCCCGAACGTTCTGCAAGGTCTTTTCACCGCAA
CGCTGTAA
 Primer design