SecReT4
Protein ID: 134288284
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6756
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]149509..150177 [-]
Productmembrane lipoprotein lipid attachment site
Component typeTraV_F
UniProt IDA4JTP1
KEGG IDbvi:Bcep1808_6756
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 2.7e-26, Aligned region: 27..146
Protein Sequence: 222 a.a.     [Download]
>gi|134288284|ref|YP_001110447.1| membrane lipoprotein lipid attachment site [Burkholderia vietnamiensis G4]
MNKRLLVASLLPLLATGCSSVFNTADNDSFSCPGMPQGIICKTPMAVYKSTNHMPAPTDNDTPYGPNVKQ
VGVKFGDDQGNVVRPELAASAASSLPGLTPVSATASARPVRTPAQVMRIWIAPWIDSKDDLHYPSYLFTE
VQPRRWSYGKTEFAGKGMVVPHRELVAVAPVQQQESMRQRGKPAAHELPDGDAQQVDTGLTAPKSADVSV
PGMPSPSDINLD
 
Nucleotide Sequence: 669 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c150177-149509 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAACAAGCGACTTCTGGTGGCCTCGCTGTTGCCGCTTCTGGCAACCGGGTGTTCCTCCGTGTTCAACA
CGGCCGACAACGATTCGTTTTCGTGCCCGGGGATGCCACAGGGAATCATCTGTAAGACACCCATGGCGGT
CTACAAATCGACCAACCACATGCCGGCGCCGACGGACAACGATACACCGTACGGCCCGAACGTGAAGCAA
GTCGGCGTGAAATTCGGAGATGACCAGGGAAACGTTGTTCGCCCTGAGCTCGCTGCTTCTGCTGCCAGCA
GCTTGCCAGGGCTGACCCCTGTCTCCGCCACCGCGTCGGCCCGCCCGGTGCGTACTCCAGCGCAGGTCAT
GCGCATCTGGATTGCGCCGTGGATCGATAGCAAGGACGACCTTCATTACCCGTCTTACCTCTTTACCGAA
GTACAACCCCGTCGCTGGTCATACGGCAAGACTGAATTTGCCGGCAAAGGGATGGTTGTACCTCACCGCG
AACTCGTCGCCGTCGCACCGGTTCAGCAGCAAGAATCGATGCGACAGCGCGGGAAACCTGCTGCGCACGA
ATTGCCCGATGGGGATGCGCAACAGGTTGATACCGGCCTGACTGCTCCAAAGAGCGCGGATGTTTCAGTG
CCGGGGATGCCGTCCCCTTCGGACATCAATCTAGATTGA
 Primer design