SecReT4
Protein ID: 134288285
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6757
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]150193..151410 [-]
ProductTraB pilus assembly family protein
Component typeTraB_F
UniProt IDA4JTP2
KEGG IDbvi:Bcep1808_6757
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.5e-43, Aligned region: 200..404
Protein Sequence: 405 a.a.     [Download]
>gi|134288285|ref|YP_001110448.1| TraB pilus assembly family protein [Burkholderia vietnamiensis G4]
MAGNVKDILKKKWLELPPKTRTAIAIGALFAGLVAVGSIFVHPGNAPRKQKIAPTVSNLLLPKPKDQTSE
QLAAANKATNDEVAKIKTELDKSNDEKAALLKKIDEMQSNSAHPDVGVNADMMKELMAMKSRLDDLEKSK
ANGKTPGLTDPLPLPSAGGKSDDDAPVAAAQPEKPHLRVTTNTKAITKVAAKQDTTPAAYLTAGSMFEGI
LLNGMDAPTSSVAQKNPVPAVMRIKTDAILPNNYNHDVKECFVLVSGYGSLSSERAQLRTETLSCVGDGG
KVLETKLDGYVVGEDGRVGARGRLVSKQGQLIAKSLAAGVLSGFSDALTPQQIPRLDLGSGSGYISTERA
TAGTIAETGVAKGFSTAAKSVAAFYLDMAKEMTPVVEIDAGRKLTIVLIKGVELK
 
Nucleotide Sequence: 1218 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c151410-150193 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGGCCGGCAACGTCAAAGACATCCTCAAGAAGAAGTGGCTCGAGCTGCCTCCGAAAACGCGTACTGCTA
TCGCGATCGGTGCGCTTTTTGCTGGCCTCGTTGCTGTGGGATCGATCTTCGTTCATCCAGGCAACGCGCC
GCGAAAGCAGAAGATTGCTCCGACGGTAAGCAACCTTCTCCTTCCGAAACCGAAGGATCAGACCAGCGAA
CAACTCGCGGCGGCGAACAAGGCGACCAACGACGAGGTCGCCAAGATCAAGACCGAACTCGACAAGAGCA
ACGATGAGAAGGCGGCCCTTCTCAAGAAGATCGACGAGATGCAGTCGAATAGCGCTCATCCGGATGTTGG
GGTCAACGCGGACATGATGAAAGAACTCATGGCCATGAAGTCCCGTCTGGACGATCTCGAAAAGTCGAAG
GCAAATGGGAAGACCCCGGGTCTTACCGATCCGCTGCCGCTGCCATCGGCCGGCGGAAAGAGCGATGACG
ACGCTCCCGTGGCGGCGGCCCAGCCCGAAAAGCCGCATTTGCGTGTGACGACGAACACGAAGGCCATTAC
GAAGGTTGCGGCGAAGCAGGACACGACCCCCGCGGCGTACCTCACGGCGGGCTCGATGTTTGAAGGCATC
CTCCTGAACGGTATGGACGCGCCGACCAGCTCGGTTGCGCAGAAGAACCCGGTTCCGGCCGTGATGCGCA
TCAAGACGGACGCGATTCTGCCCAACAACTACAACCACGACGTAAAGGAATGCTTCGTCCTGGTCTCCGG
CTACGGCAGCCTGTCCAGCGAACGCGCGCAACTGCGCACAGAGACGTTGTCGTGTGTCGGTGACGGCGGG
AAGGTGCTGGAGACGAAACTCGATGGATACGTCGTCGGTGAAGATGGTCGCGTAGGAGCTCGCGGTCGCC
TCGTATCGAAGCAAGGGCAATTGATCGCCAAGTCGCTTGCTGCCGGTGTGTTGAGCGGATTTAGCGACGC
ACTCACGCCTCAGCAGATTCCGCGTCTCGATCTTGGCTCCGGCAGCGGTTACATCAGCACCGAACGTGCG
ACGGCCGGCACGATCGCCGAAACCGGCGTTGCAAAGGGCTTTTCTACGGCCGCCAAGTCAGTCGCCGCGT
TCTATCTCGATATGGCCAAGGAAATGACGCCTGTCGTGGAAATCGACGCGGGCCGAAAACTCACCATCGT
CCTTATCAAGGGCGTGGAACTCAAATAA
 Primer design