SecReT4
Protein ID: 134288286
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6758
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]151412..152263 [-]
Productputative transfer protein TraK
Component typeTraK_F
UniProt IDA4JTP3
KEGG IDbvi:Bcep1808_6758
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 2.4e-24, Aligned region: 62..275
Protein Sequence: 283 a.a.     [Download]
>gi|134288286|ref|YP_001110449.1| putative transfer protein TraK [Burkholderia vietnamiensis G4]
MKRIAFVVAALFALPALAQELPPLPKVANAQVRLNALAAKHVRKVAAQPMPGLGTMPGDSSVYKTNVVRV
STDRTEVINVSGLLPNRIATPFANPQSIDNQSEDFEVQAVGQSLYVTMKSDKPVALYVTGDKPNDPVISL
TLVPKNLPAQTVTLQLDKPTTGVNGEASDGSEQAPDSNVYTDKLRYVLRQLAIGKVPEGFSEGALPRSVA
RMGQVVAYPLTRYSGPSYDIFRYRIEAVADNVELGEDAFYSAGVRAVAFFPNASLHRGESTEVFVVSDKT
ESN
 
Nucleotide Sequence: 852 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c152263-151412 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAGCGCATTGCATTCGTCGTTGCTGCGCTGTTTGCGCTGCCAGCTCTCGCACAAGAGCTCCCCCCGC
TTCCCAAGGTCGCCAACGCTCAGGTGCGTCTTAATGCGCTTGCGGCAAAGCATGTTCGCAAGGTCGCTGC
TCAACCGATGCCCGGTCTTGGAACGATGCCCGGCGATTCGTCGGTTTACAAGACGAACGTTGTCCGTGTC
AGTACGGATCGGACTGAAGTGATCAATGTTTCCGGCCTGTTGCCGAACCGCATCGCCACACCGTTCGCTA
ACCCGCAATCCATCGACAACCAGTCTGAGGATTTCGAAGTTCAAGCGGTAGGGCAATCGCTCTATGTGAC
GATGAAGTCCGACAAACCCGTCGCGCTCTACGTCACAGGTGACAAGCCGAATGATCCCGTCATCTCGCTG
ACCCTGGTACCGAAGAACCTACCCGCGCAGACGGTCACGTTGCAACTGGACAAACCGACCACCGGAGTCA
ACGGCGAAGCGTCCGACGGCAGCGAGCAGGCCCCCGACAGCAATGTCTACACCGACAAGCTCCGCTACGT
ACTGCGCCAACTCGCGATTGGCAAAGTTCCTGAGGGATTCAGCGAAGGTGCACTTCCGCGCTCGGTTGCG
CGTATGGGACAAGTCGTGGCGTATCCGCTGACCCGCTACAGCGGCCCAAGTTACGACATCTTCCGCTACC
GCATCGAAGCCGTCGCCGACAACGTCGAACTCGGTGAAGACGCCTTCTATTCCGCAGGCGTTCGAGCAGT
TGCGTTCTTCCCGAATGCATCGCTGCATCGCGGTGAGTCGACCGAAGTGTTCGTCGTGTCCGACAAGACG
GAGAGCAACTGA
 Primer design