SecReT4
Protein ID: 134288287
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6759
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]152260..152967 [-]
Productsex pilus assembly protein
Component typeTraE_F
UniProt IDA4JTP4
KEGG IDbvi:Bcep1808_6759
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 1.2e-11, Aligned region: 20..150
Protein Sequence: 235 a.a.     [Download]
>gi|134288287|ref|YP_001110450.1| sex pilus assembly protein [Burkholderia vietnamiensis G4]
MKLPLLTSSWQGANKFAGAMLFSNVILASLLAASMVGNLSRHETTRLVPPYLAKAVSVGWDTADVEYLEG
IGLYVATLTANVTPKNVNFVADRLSQLLTPRVYQGVRQQILALAQDPVFNSNGGSVRFEATKVVSEKETQ
KVYVIGQMTTQSVNSRDTKSAVIEMKIVMKDGRPWVDSMDHYDGADPHTLTWIEKNPGKFQQIQKQQADV
AASATQPVPEQSAQASAQTNSEVAQ
 
Nucleotide Sequence: 708 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c152967-152260 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGAAACTGCCTTTGCTGACCTCCTCATGGCAAGGAGCCAACAAGTTCGCGGGAGCCATGCTTTTCTCGA
ACGTCATCCTCGCGTCGCTGCTGGCCGCGTCCATGGTTGGGAATCTTTCGAGGCACGAGACGACTCGCCT
TGTTCCTCCGTATCTCGCTAAGGCGGTCTCCGTAGGCTGGGACACGGCCGACGTGGAATACCTCGAGGGT
ATTGGTCTGTATGTCGCCACCCTGACGGCAAACGTGACACCCAAGAACGTGAATTTCGTTGCTGATCGCC
TTTCGCAACTACTGACGCCGCGCGTTTACCAAGGTGTTCGGCAGCAGATTCTCGCGCTCGCGCAGGACCC
AGTCTTCAATAGCAACGGCGGGTCGGTGCGCTTCGAGGCCACCAAAGTCGTCTCGGAAAAGGAGACACAA
AAGGTCTACGTGATCGGCCAGATGACGACTCAAAGCGTCAACTCGCGCGATACCAAGTCGGCCGTCATTG
AAATGAAGATCGTCATGAAGGACGGTCGCCCTTGGGTCGACTCAATGGATCACTACGACGGGGCCGATCC
GCACACGCTCACATGGATCGAAAAGAACCCGGGCAAGTTCCAGCAAATCCAGAAGCAGCAGGCCGATGTC
GCCGCTAGCGCGACGCAACCGGTCCCCGAACAGTCTGCCCAAGCTTCGGCTCAAACCAACTCGGAGGTCG
CGCAATGA
 Primer design