SecReT4
Protein ID: 134288288
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6760
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]153048..153332 [-]
Productpilus assembly protein
Component typeTraL_F
UniProt IDA4JTP5
KEGG IDbvi:Bcep1808_6760
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.2e-17, Aligned region: 3..92
Protein Sequence: 94 a.a.     [Download]
>gi|134288288|ref|YP_001110451.1| pilus assembly protein [Burkholderia vietnamiensis G4]
MTEIDIPRYIDNQPQLFFWELDEAIIFIGCLAGGISLGGYFTLVSMAMGIFAVKAFKRFKNGALEGILYH
LCYWAGVIGLNKQYPDSSKRDFFF
 
Nucleotide Sequence: 285 bp     [Download]
>gi|134288152|ref|NC_009230.1|:c153332-153048 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGACCGAGATCGACATCCCGCGTTACATCGACAACCAGCCGCAACTGTTCTTCTGGGAACTCGACGAAG
CGATTATCTTCATCGGTTGCCTCGCCGGTGGCATCTCACTGGGTGGCTATTTCACCCTCGTGAGCATGGC
AATGGGCATATTCGCAGTGAAGGCGTTCAAGCGCTTCAAAAACGGCGCCTTGGAGGGAATTCTGTATCAC
CTCTGTTACTGGGCTGGGGTTATTGGGCTGAACAAGCAGTACCCGGACTCTTCGAAGCGCGACTTCTTCT
TTTAA
 Primer design