SecReT4
Protein ID: 134288291
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6763
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]155229..156983 [+]
Productputative TraG family protein
Component typeTraD_F
UniProt IDA4JTP8
KEGG IDbvi:Bcep1808_6763
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.9e-13, Aligned region: 353..517
TraG-D_C [PF12696], Evalue: 1.5e-10, Aligned region: 372..506
AAA_10 [PF12846], Evalue: 2.5e-10, Aligned region: 102..450
Protein Sequence: 584 a.a.     [Download]
>gi|134288291|ref|YP_001110454.1| putative TraG family protein [Burkholderia vietnamiensis G4]
MYRTKLGGSLDTLALSSLGAGALLSSPYFSSMPATVPMALGAAGSAYLGNRLFDFWRQQSVLESKISIQS
AADLTRPDGLLIGYTTDTGQPMYIPDEDLMRHGFIGGQSGVGKTVLGKLLMFQQIQRGGGLAFIDGKMNA
DDIETIYQYCCWCGREQDLLILNPGNPAMSNSYNPILRGEPDEVSARVLSLIPSTENNPGADHYKQSANQ
GISTLVAALQTAGLAYNFIDFSILLMNHKAIEELETRLKKMQPHHDATKNLSLFLEQYKGGGKPGSGLEN
MVDIKKMKDTFGGVGGRMYMFGTGNFGKVMNTYTPDIDLFEAIRSNKIIYVALPTMGKNEAASNFGKMFL
GDLRTAISWVQALPENLRPNPPFLVFMDELGSYAVASLARPFEQARSAHIALFPAAQTLANLEVVSADFK
EMVIGNTWTKIIFKLGSQETAKEFAELIGMQIGIAKSLSATQNESTNSPMLNMTPEGGAGSGAGLSEGER
EQEEYKVSPDDLKALSKGECIVMYGGDTIFNLRVPMISIDKKLQKEIGRVRINHFRKPSVEGADFFKNSD
KYLGGSSVPTGGRKRDFAQELANE
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|134288152|ref|NC_009230.1|:155229-156983 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGTACCGCACGAAACTCGGCGGGTCGTTGGACACCCTCGCCTTGAGCTCTCTCGGGGCGGGAGCACTTC
TGTCATCGCCATATTTCTCCAGCATGCCAGCCACGGTGCCAATGGCATTGGGCGCTGCGGGAAGCGCCTA
TCTCGGGAATCGTCTGTTTGATTTCTGGCGGCAACAGAGCGTGCTCGAATCGAAAATCAGTATCCAGTCC
GCTGCGGATCTGACGCGACCGGATGGGCTACTCATTGGATATACGACTGACACGGGTCAGCCTATGTACA
TCCCCGATGAGGACCTGATGCGTCATGGCTTTATCGGTGGGCAGTCTGGCGTCGGTAAGACGGTGCTGGG
CAAGCTGCTCATGTTTCAGCAGATCCAGCGTGGTGGCGGGCTGGCGTTCATTGACGGGAAAATGAACGCC
GACGATATCGAGACGATCTATCAGTATTGCTGCTGGTGTGGACGTGAACAGGATCTTCTGATTCTCAACC
CGGGCAATCCGGCGATGAGCAACAGCTACAACCCCATTCTTCGCGGCGAGCCGGATGAAGTGTCAGCGCG
CGTGCTGTCTCTCATCCCTTCCACGGAGAATAACCCGGGAGCGGACCACTACAAGCAGAGTGCGAACCAG
GGTATCTCAACTCTCGTCGCCGCACTCCAGACGGCAGGTCTCGCGTATAACTTCATCGACTTCTCGATCC
TCCTGATGAACCACAAGGCGATCGAGGAGCTCGAAACGCGCTTGAAGAAGATGCAACCTCATCATGACGC
GACGAAGAACCTGTCGCTGTTCCTTGAGCAGTACAAGGGGGGCGGTAAGCCAGGCTCTGGCCTCGAGAAC
ATGGTCGACATCAAGAAGATGAAGGATACGTTCGGTGGGGTCGGCGGCCGGATGTACATGTTCGGGACGG
GTAATTTCGGCAAGGTGATGAACACCTATACGCCGGATATCGACCTGTTTGAGGCGATCAGGAGCAACAA
GATCATCTATGTCGCGCTGCCCACGATGGGCAAGAACGAAGCGGCGTCGAACTTCGGCAAGATGTTTTTG
GGGGATCTCCGTACCGCAATCTCATGGGTACAGGCTCTGCCGGAAAACCTTCGACCCAATCCGCCCTTTC
TCGTGTTCATGGACGAGCTCGGCTCGTACGCAGTTGCATCGCTCGCGCGCCCCTTCGAGCAGGCACGCAG
TGCTCACATTGCGCTCTTTCCGGCAGCACAAACACTCGCAAACCTTGAAGTCGTATCGGCGGATTTCAAG
GAAATGGTGATCGGAAATACATGGACCAAGATCATCTTCAAGCTGGGTTCACAAGAGACTGCGAAGGAAT
TCGCGGAGCTGATCGGCATGCAGATTGGTATCGCGAAGTCCCTAAGCGCAACGCAAAACGAGTCGACCAA
CAGCCCGATGCTGAACATGACGCCAGAAGGCGGTGCTGGCAGCGGCGCGGGTCTGTCCGAGGGAGAGCGT
GAGCAGGAAGAGTACAAAGTGTCGCCGGATGATCTGAAGGCACTGAGCAAGGGCGAGTGCATTGTCATGT
ACGGAGGTGACACGATTTTCAACCTGCGCGTGCCAATGATCTCGATCGACAAGAAACTTCAAAAGGAAAT
CGGCCGCGTGCGCATCAATCACTTCCGTAAGCCGAGCGTTGAAGGGGCGGATTTCTTCAAGAACAGTGAC
AAGTATCTTGGCGGAAGTAGCGTCCCCACAGGCGGTCGAAAGCGCGACTTCGCGCAAGAGCTCGCGAACG
AATAA
 Primer design