SecReT4
Protein ID: 134288292
T4SS name [ID]Tra_F [595]
Gene symbol-
Locus tagBcep1808_6764
StrainBurkholderia vietnamiensis G4
Repliconplasmid pBVIE01 [GenBank: NC_009230] [Browse all T4SS(s) in this replicon]
Location [Strand]157012..158355 [+]
Producthypothetical protein
Component typeTraD_F
UniProt IDA4JTP9
KEGG IDbvi:Bcep1808_6764
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 447 a.a.     [Download]
>gi|134288292|ref|YP_001110455.1| hypothetical protein Bcep1808_6764 [Burkholderia vietnamiensis G4]
MTGQIVRADGIVLGEEKGEAVAVHLQDADLRRHVLIVAPSGVGSRELLAQALSQQIERGGAILVFDGDSD
TAILNSIASACRKHSRQQDLLVVKPHDPDLSNTYNVILSSDVEAAVAQALTTVPEAEDNDGVRHNREEIR
RGLSIIVSALKRAGLAYTFLDLSLFIIKPESLQDLLVSLEQVAPDSAETTALSTWLDPFRKDGVIDPLPL
KQRMGGIAGRLYMFASGKLGKVLNTYAPEVDVRRALDESKVIYMDVPGSAQHLVATALREMIYLDVAGAL
ADRSRDVGGVPPIIVFNGAASCDRALANRLLAQGRSMGISTWLRVASMGDLAKKSAVLAEVVLANTGSQI
VFNLEGSDESLLFAGSLGREVTGGGSNETSDPVVSCPDDLHDLASREFVLLSPDARARRGFAPRVGDGQE
VFTREQLNRGHGTPRDGADRFTRTSMA
 
Nucleotide Sequence: 1344 bp     [Download]
>gi|134288152|ref|NC_009230.1|:157012-158355 Burkholderia vietnamiensis G4 plasmid pBVIE01, complete sequence
ATGACAGGTCAAATTGTCCGGGCCGATGGCATCGTACTCGGTGAAGAGAAGGGCGAGGCTGTTGCGGTAC
ATCTTCAGGATGCAGATTTGCGGCGCCATGTCCTGATTGTCGCCCCTAGTGGTGTTGGCTCGCGAGAACT
GCTCGCGCAGGCGCTGTCACAACAGATCGAACGAGGTGGTGCAATCCTCGTCTTCGACGGTGACTCCGAT
ACCGCTATTCTCAACTCGATCGCAAGCGCTTGCAGAAAGCATTCTCGTCAGCAGGATCTGCTGGTCGTGA
AGCCTCACGATCCCGACCTCAGCAACACTTACAACGTGATCCTATCGAGCGACGTGGAGGCGGCAGTTGC
CCAGGCGCTCACCACGGTGCCGGAAGCGGAAGATAACGACGGGGTCCGCCACAACCGGGAAGAGATCCGT
CGAGGGCTTTCTATAATCGTGTCTGCTCTCAAGCGCGCTGGCCTAGCTTACACCTTCCTCGACCTATCGT
TGTTCATCATCAAGCCGGAATCCTTGCAGGACCTGCTTGTGTCACTGGAACAGGTAGCACCCGATAGCGC
TGAAACCACTGCGTTGTCCACGTGGCTTGATCCGTTTCGCAAAGACGGGGTGATCGATCCTCTCCCCCTC
AAGCAACGAATGGGAGGGATCGCCGGACGGTTGTACATGTTTGCCAGCGGCAAGTTGGGCAAGGTTCTGA
ACACGTACGCGCCCGAAGTCGATGTCCGGCGTGCACTCGATGAATCCAAGGTGATCTACATGGATGTTCC
TGGTTCAGCACAGCATCTTGTGGCGACGGCACTTCGGGAAATGATCTATCTCGATGTAGCGGGCGCACTC
GCCGACCGATCGCGCGATGTCGGGGGAGTCCCGCCGATTATCGTTTTCAACGGTGCTGCGAGCTGCGATC
GTGCTCTCGCAAACCGCCTGTTGGCACAAGGACGCAGCATGGGTATATCGACGTGGCTTCGCGTTGCATC
CATGGGTGATCTGGCGAAGAAGAGCGCGGTACTGGCCGAAGTTGTGCTCGCCAACACAGGGTCTCAGATT
GTGTTCAACCTGGAAGGAAGCGACGAATCGCTCCTGTTTGCCGGCTCCCTCGGTCGTGAGGTCACCGGCG
GTGGGAGCAATGAGACGAGCGATCCGGTTGTCTCGTGTCCCGACGACCTACACGATCTTGCGTCGCGGGA
GTTCGTGCTTCTGTCCCCGGATGCGAGGGCTCGTCGCGGCTTCGCGCCGCGTGTCGGTGATGGTCAAGAG
GTATTCACGCGCGAACAACTCAATCGCGGCCATGGCACCCCGCGCGATGGTGCCGACCGCTTCACCCGTA
CGAGCATGGCGTAA
 Primer design