SecReT4
Protein ID: 134291206
T4SS name [ID]VirB [375]
Gene symbol-
Locus tagBcep1808_5788
StrainBurkholderia vietnamiensis G4
Repliconchromosome 3 [GenBank: NC_009254] [Browse all T4SS(s) in this replicon]
Location [Strand]370362..371057 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDA4JR17
KEGG IDbvi:Bcep1808_5788
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.4e-50, Aligned region: 11..219
Protein Sequence: 231 a.a.     [Download]
>gi|134291206|ref|YP_001114975.1| VirB8 family protein [Burkholderia vietnamiensis G4]
MSLHGYGRVLDIEASLTHLQERSERRAWHVAYAAVGIAVLSTGALAVMVPFYRVVPLPIEVDRLTGESQV
IDVLDARHVHTKEIQDKHWVETYVRARERYDWGLLQMDYDSVLSMSDDVVARDYRGLYSGPEPLDRQLGA
SVERRIRILSVTLPPDEPGHAVVHVERTSFKNGEAHAEPTQRFVITLAYTYRPPVFTRESVAIANPFGFK
VTAYSRDTEYTPSASAAGGTP
 
Nucleotide Sequence: 696 bp     [Download]
>gi|134290884|ref|NC_009254.1|:370362-371057 Burkholderia vietnamiensis G4 chromosome 3, complete sequence
ATGAGCTTGCACGGTTATGGCCGCGTACTTGACATCGAGGCGTCGTTGACTCACCTGCAGGAGCGCTCGG
AACGGCGCGCGTGGCACGTTGCTTACGCGGCAGTTGGCATTGCCGTGCTGAGCACGGGAGCGCTCGCTGT
GATGGTGCCGTTCTATCGCGTCGTGCCTCTGCCCATCGAGGTCGATCGCCTGACAGGGGAATCCCAGGTG
ATCGACGTGCTCGACGCCCGCCACGTGCACACGAAGGAAATCCAGGACAAGCACTGGGTCGAGACATATG
TGCGCGCACGCGAGCGCTACGACTGGGGACTGCTGCAGATGGACTACGACAGCGTACTTTCGATGAGTGA
CGACGTGGTCGCTCGCGATTACCGTGGCCTCTACAGCGGTCCCGAGCCACTGGATCGGCAGCTGGGTGCG
AGTGTTGAGCGGCGGATCCGGATTCTCTCGGTCACGCTGCCGCCTGACGAACCCGGCCATGCGGTTGTGC
ACGTCGAACGGACGTCGTTCAAGAATGGCGAAGCGCATGCCGAGCCAACCCAGCGCTTCGTGATCACGCT
GGCTTATACCTACCGGCCGCCCGTATTCACACGTGAGAGCGTGGCGATCGCCAATCCATTCGGCTTCAAG
GTCACCGCCTATAGCCGGGATACGGAATATACGCCGTCGGCGTCGGCAGCCGGAGGCACACCATGA
 Primer design