SecReT4
Protein ID: 134291209
T4SS name [ID]VirB [375]
Gene symbol-
Locus tagBcep1808_5791
StrainBurkholderia vietnamiensis G4
Repliconchromosome 3 [GenBank: NC_009254] [Browse all T4SS(s) in this replicon]
Location [Strand]373094..374212 [+]
Producttype II secretion system protein E
Component typeVirB11
UniProt IDA4JR20
KEGG IDbvi:Bcep1808_5791
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-60, Aligned region: 31..339
FtsK_SpoIIIE [PF01580], Evalue: 7e-05, Aligned region: 180..212
Protein Sequence: 372 a.a.     [Download]
>gi|134291209|ref|YP_001114978.1| type II secretion system protein E [Burkholderia vietnamiensis G4]
MMTHSPPLDATRNAVLARLPDDASVRELMRPFARLLDDPEVTELVINRPQRVLTENSVGWHGHDYADLDF
DRLMSFAVSVATLTNQEVSSRYPILSALLPDDARIQIVVPPVVPARTVSVTIRRPSPDEKTLNACRDEGL
FDATVWRRPDGLDSAWADLSAEDRDLVQCLEEHDWVTLFEHAVRGRRNIAVVGNTGSGKTSFMKTLCRSI
PATERIVTIEDVRELVIRHVENCVHLLYSKGGHGHAQVTPADLIASAMRMRPDRVLLAELRGAEAYDFLK
LLTTGHAGSITSYHAPNVTVAIERFALMAKEHPEAAAWDDAALKRLLFLTVDLVAHMESRAVFDAEDKQT
GRRWGMTEVWFDPVRKARTAFV
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|134290884|ref|NC_009254.1|:373094-374212 Burkholderia vietnamiensis G4 chromosome 3, complete sequence
ATGATGACTCACTCGCCCCCGTTGGATGCAACACGCAACGCCGTGCTGGCTCGGTTACCCGACGACGCCT
CCGTGCGCGAACTGATGCGACCGTTTGCGCGGCTGCTCGACGATCCCGAGGTGACTGAATTGGTGATCAA
TCGGCCGCAGCGTGTGTTGACCGAGAACTCGGTCGGTTGGCACGGCCACGACTACGCCGATCTCGATTTC
GACCGGCTGATGTCATTCGCGGTGTCGGTCGCCACCCTGACTAACCAGGAAGTATCGTCGCGGTATCCGA
TTCTGTCGGCGCTGTTGCCGGACGACGCACGGATCCAGATTGTGGTTCCGCCGGTCGTACCGGCGCGCAC
GGTGTCGGTCACGATTCGCCGTCCGTCCCCGGACGAGAAGACGCTCAACGCGTGTCGGGACGAGGGATTG
TTCGACGCGACGGTATGGCGCAGGCCAGACGGGCTCGACTCAGCTTGGGCGGACTTGTCCGCAGAAGACC
GCGATCTCGTCCAATGCCTGGAAGAGCATGATTGGGTTACCTTATTCGAGCATGCTGTCAGGGGACGACG
CAACATCGCGGTGGTCGGTAATACGGGGTCCGGCAAGACCAGTTTCATGAAGACCTTGTGCCGCTCGATT
CCTGCGACCGAGCGGATCGTGACGATCGAGGACGTGCGGGAGCTAGTCATTCGGCACGTCGAGAACTGCG
TGCATCTTCTCTACAGCAAGGGCGGGCATGGTCACGCGCAGGTGACGCCAGCAGACCTGATTGCAAGCGC
GATGCGCATGCGACCGGATCGCGTGCTGTTGGCCGAACTGCGTGGTGCCGAAGCCTACGACTTCCTGAAG
CTGCTGACGACCGGACACGCGGGGTCGATCACGAGCTATCACGCGCCCAATGTGACCGTCGCGATTGAGC
GATTCGCGCTGATGGCAAAGGAACATCCGGAGGCCGCAGCTTGGGATGATGCCGCACTCAAGCGGTTGCT
GTTCCTGACAGTCGATCTCGTCGCGCACATGGAGTCACGCGCGGTGTTCGACGCAGAGGACAAACAGACC
GGCAGGCGCTGGGGCATGACCGAAGTTTGGTTCGATCCGGTGCGCAAGGCGCGCACCGCGTTTGTATAG
 Primer design