SecReT4
Protein ID: 134291211
T4SS name [ID]VirB [375]
Gene symbol-
Locus tagBcep1808_5793
StrainBurkholderia vietnamiensis G4
Repliconchromosome 3 [GenBank: NC_009254] [Browse all T4SS(s) in this replicon]
Location [Strand]374593..376311 [+]
ProductTRAG family protein
Component typeVirD4
UniProt IDA4JR22
KEGG IDbvi:Bcep1808_5793
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.6e-107, Aligned region: 16..450
TraG-D_C [PF12696], Evalue: 2.4e-27, Aligned region: 296..417
TrwB_AAD_bind [PF10412], Evalue: 5.9e-22, Aligned region: 207..431
Protein Sequence: 572 a.a.     [Download]
>gi|134291211|ref|YP_001114980.1| TRAG family protein [Burkholderia vietnamiensis G4]
MTTHGRLDTPPAIVVGIWRGRYLRFGGQQFVLLAAPARSGKGVGVVIPNLLTFPDSVVVLDIKQENYATT
SGFRRAHGQDVYLFNPFAEDGRTHRYNPLSAISDGLFRVGDILAIGYALYPPGGHDDFWKDQARNLFLGI
VLLLCEWRDAHRAGKDASSPDFPVTMGEVLRQSSGNGMPVKTYLQRALVRHRGLLSQQCVDALNRFLSND
DKVLASVLATFNAPLTIWANPIVDAATSADDFDLRDLRRRRISIYIGVTPDHLAEAALIVNLLFSQIINL
NTKQLPEADPTLKFQCLLVFDEMTAIGKIHILPRAIAYMPGFNLRVLSIVQSIAQFESVYGRSDARTIIT
NHAMQILYAPREQKDANEYSEMLGTFTDQSRSVSRPNAFFGGRGGSSESVSEQRRPLLLPQELKELERDK
EIILLENTKPILADKICYWRDPEFAARVMPAPSVPTLNMEHFSAVVQRRLRDLHPDELDPQDAGLVHVPH
EYLEVLQAWNPRDLPPNLADLSEEEAVAYVERHFVLLGMPAGKVEQVRRCLSASDLDVAELDFVEPARQA
AVSGAPVGEVRQ
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|134290884|ref|NC_009254.1|:374593-376311 Burkholderia vietnamiensis G4 chromosome 3, complete sequence
ATGACGACGCATGGCCGCCTTGATACGCCACCTGCGATTGTCGTTGGAATATGGCGCGGCCGCTACCTGC
GATTTGGAGGTCAGCAGTTCGTGCTACTTGCCGCACCTGCCCGCTCCGGCAAGGGAGTTGGCGTAGTGAT
CCCGAATCTGCTCACCTTTCCCGATTCGGTCGTGGTGCTCGACATCAAGCAGGAAAACTATGCGACCACA
TCCGGCTTTCGCCGCGCACATGGACAAGATGTGTATCTGTTCAATCCGTTTGCCGAAGATGGCCGGACAC
ACCGCTACAACCCACTGTCGGCGATCTCAGATGGCTTGTTCCGGGTGGGCGACATTCTCGCGATCGGCTA
TGCACTGTATCCACCCGGAGGTCACGACGATTTCTGGAAAGATCAGGCGCGAAATCTGTTCCTCGGCATC
GTGCTCCTGCTGTGCGAATGGCGCGATGCGCACCGGGCTGGCAAGGACGCGTCGAGTCCCGATTTTCCCG
TCACGATGGGCGAAGTGCTGCGGCAGTCGTCGGGCAATGGCATGCCAGTCAAAACCTATTTGCAGCGAGC
GCTGGTCCGGCATCGTGGCTTGCTCTCGCAACAATGCGTGGATGCACTGAATCGCTTCCTGTCTAATGAC
GACAAGGTGCTGGCGAGCGTGTTGGCGACCTTCAATGCGCCGCTGACGATCTGGGCCAACCCGATTGTCG
ACGCAGCAACGAGCGCGGACGATTTCGATCTGCGCGATCTGCGGCGCCGACGTATTTCCATCTATATCGG
TGTCACGCCAGATCATCTGGCGGAAGCAGCCTTGATCGTGAACCTGCTCTTTTCGCAGATTATCAACTTG
AACACGAAGCAGCTGCCCGAAGCCGATCCTACACTCAAGTTCCAATGCCTGCTTGTGTTCGATGAGATGA
CGGCAATCGGAAAGATCCACATTCTTCCGCGCGCGATTGCCTATATGCCGGGTTTCAACCTGCGTGTGCT
GTCGATCGTGCAGTCGATCGCGCAATTCGAATCCGTTTACGGGCGATCCGATGCCCGTACCATCATCACG
AACCACGCGATGCAGATCCTCTATGCACCGCGCGAGCAGAAGGACGCGAACGAATACTCGGAAATGCTCG
GTACGTTTACCGACCAATCGCGCAGTGTGAGCCGCCCCAACGCATTTTTTGGCGGCCGGGGTGGTTCAAG
CGAAAGCGTATCTGAACAGCGCCGGCCGTTGCTGTTGCCGCAGGAATTGAAGGAACTGGAGCGCGACAAG
GAAATCATCTTGCTCGAAAACACCAAGCCGATTTTGGCCGACAAGATCTGCTATTGGCGCGATCCCGAGT
TTGCGGCCCGCGTCATGCCGGCACCGTCCGTGCCCACCCTGAACATGGAGCATTTCTCCGCGGTGGTCCA
GCGTCGCTTGCGCGACTTGCATCCCGATGAGCTCGACCCGCAGGACGCGGGGCTCGTTCATGTGCCGCAC
GAGTACCTTGAAGTACTGCAGGCATGGAATCCGCGCGATCTGCCGCCGAACCTCGCAGACCTCAGCGAGG
AGGAGGCTGTGGCCTATGTCGAGCGGCATTTCGTGCTGCTGGGTATGCCGGCCGGTAAGGTTGAGCAGGT
GAGACGTTGCCTGAGCGCAAGCGATCTTGATGTGGCTGAGCTCGATTTTGTTGAACCGGCGCGCCAGGCA
GCCGTGAGCGGTGCGCCAGTCGGGGAAGTCCGGCAATGA
 Primer design