SecReT4
Protein ID: 13475352
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6397
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5220585..5221553 [+]
Productconjugal transfer protein traB
Component typeTrbB
UniProt IDQ989J4
KEGG IDmlo:mlr6397
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.5e-90, Aligned region: 22..287
FtsK_SpoIIIE [PF01580], Evalue: 8.5e-05, Aligned region: 141..171
Protein Sequence: 322 a.a.     [Download]
>gi|13475352|ref|NP_106916.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MSAHPEADHRRRAMLRTAMGPTITEALADPLVIEVMVNPDGALRLDRLGEGRIDTAVHMHPSEAERIIRL
VASHVRAEAHADNPIVSAELPSGERFEGLLPPVVLAPCFAIRKPAAKLYTLANYVADRIMLPLQADALIK
AVRERRNILVAGGTSSGKTTLANALLAEVAECDERVILIEDTRELQCAAKDCVALRTRRGSVTLADLVRS
TLRLRPDRIIVGEVRGAEALDMLKAWNTGHPGGIATVHANSARSALYRIEQLAQEAVVTVPRRLIADAID
LIVFIAGRGSSRRIDAIAEVTGLDGSGDYAVSPLTPPQLQQL
 
Nucleotide Sequence: 969 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5220585-5221553 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGAGCGCTCATCCAGAGGCCGACCACCGACGCCGCGCCATGCTGCGCACCGCCATGGGTCCGACGATCA
CTGAGGCGCTGGCCGATCCATTGGTCATCGAGGTGATGGTCAATCCCGATGGTGCGCTGCGGCTCGACCG
GCTGGGAGAAGGCCGAATCGATACGGCCGTGCATATGCATCCTTCCGAGGCGGAACGCATCATCCGCCTG
GTCGCTTCCCACGTGCGTGCCGAGGCGCATGCGGACAATCCGATTGTCAGCGCCGAATTGCCATCGGGCG
AACGCTTCGAGGGACTGCTGCCGCCTGTCGTGCTGGCGCCTTGCTTTGCCATCCGCAAACCAGCCGCAAA
GCTCTACACGCTGGCCAACTATGTTGCGGATCGCATCATGTTGCCGCTGCAGGCCGATGCGTTGATAAAG
GCAGTCCGAGAACGGCGCAACATCCTTGTCGCCGGAGGCACGTCGTCGGGTAAGACGACGCTTGCCAATG
CGCTGCTGGCCGAAGTCGCCGAATGCGACGAGCGAGTGATCCTCATCGAGGACACCCGCGAACTGCAATG
CGCAGCAAAGGACTGCGTTGCCCTGAGAACCAGGCGGGGCTCGGTCACACTCGCCGATCTCGTGCGCTCG
ACGCTCCGGCTCCGTCCCGACCGCATCATCGTCGGTGAAGTCAGGGGCGCGGAAGCGCTGGACATGCTCA
AGGCATGGAACACCGGGCACCCCGGCGGCATCGCCACGGTTCATGCCAATTCGGCGCGCTCTGCCCTCTA
TCGCATCGAGCAGCTTGCACAGGAAGCTGTCGTCACCGTGCCGCGCCGCCTCATCGCCGATGCCATCGAT
CTCATCGTCTTCATCGCGGGGCGCGGCTCGTCGCGCCGCATCGATGCAATCGCTGAGGTCACAGGTCTCG
ACGGCAGCGGCGACTACGCCGTCTCCCCACTCACGCCTCCGCAACTCCAGCAACTCTGA
 Primer design