SecReT4
Protein ID: 13475353
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6398
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5221565..5221873 [+]
Productconjugal transfer protein TRBC
Component typeTrbC
UniProt IDQ989J3
KEGG IDmlo:mlr6398
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 3.2e-25, Aligned region: 2..92
Protein Sequence: 102 a.a.     [Download]
>gi|13475353|ref|NP_106917.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MRKKLRFLSFAALAFLLTVPAHAAGSGMPWEQPLQQILESVQGPVAKIVAVIIIITTGLTLAFGDTAGGF
RRLIQIVFGLSIAFAASSFFLSFFSFGGGALV
 
Nucleotide Sequence: 309 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5221565-5221873 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCGCAAGAAGCTCCGCTTTCTTTCGTTTGCCGCGCTCGCGTTTCTTCTCACAGTTCCGGCGCACGCTG
CCGGCTCCGGCATGCCTTGGGAACAGCCGCTGCAGCAGATCCTGGAATCGGTGCAGGGACCGGTCGCCAA
AATCGTCGCGGTGATCATCATCATCACCACCGGCCTGACCCTTGCCTTCGGCGATACTGCAGGCGGTTTC
CGCCGGCTGATTCAGATCGTCTTCGGCCTGTCGATCGCCTTCGCCGCATCGAGCTTCTTCCTCTCGTTCT
TCTCCTTCGGCGGCGGGGCGCTCGTCTGA
 Primer design