SecReT4
Protein ID: 13475354
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6400
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5222139..5224589 [+]
Productconjugal transfer ATPase TrbE
Component typeTrbE
UniProt IDQ989J2
KEGG IDmlo:mlr6400
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 6.7e-37, Aligned region: 449..726
CagE_TrbE_VirB [PF03135], Evalue: 1.4e-19, Aligned region: 182..289
CagE_TrbE_VirB [PF03135], Evalue: 1.4e-19, Aligned region: 308..389
Protein Sequence: 816 a.a.     [Download]
>gi|13475354|ref|NP_106918.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MLNLSEYRGKADRLADHLPWAALVAPGIVLNKDGSVQRTLRFRGPDLESSTEAELLGICARANNALRRLG
SGWTLFFEAERIEALGYPSSRFPDAASWLVDEERRAAFEGKVAHFESRCHLTLLSMPPPDAQARAESALV
DSHHSEGERDWRQEMARFRDETDRVLDLLSGFMPEVRPLDDAETLTYLHDTISTRRHPVAVPETPMYLDG
ILVDVPLTGGLEPMLGEQHLRTLTILGFPNLTRPGILDALNHQDFAYRWMTRFIPLDKTEATKTLTRLRR
QWFAKRKSIVAILREVVSNEPVPLVDSDADNKALDADEALQALGGDHVGFGYLTATVTVWDEDRQAAAEK
LRAVERIINGLGFTTIRESVNAVEAWLGSLPGHVYANVRQPLVHTLNLAHLMPLSSVWAGPAANEHLAEV
TGREAPPLLIAETSGSTPFRLSSHVEDVGHMLIVGPTGAGKSVLLALIALQFRRYAGAQVYVFDKGNSAR
AATLAMGGEHHVLGSDGALAFQPLRNIGDQGRRSWAAEWIAGLIAHENVTLTPEVKEAIWSALNSLATAP
AQERTLTGLSVLLQSNALKSALMPYTLDGPFGRLLDADDDRLALSDVQCFETEELMHSQSAVLPVLTYLF
HRLEERFDGRPTLLMLDEAWVYLDNPLFAARIREWLKVLRKKNVSVIFATQSLADIAGSAIAPAIIESCP
QRIFLPNDRAVEPQARTAYERFGLNDRQIELIARATPKRHYYLQSRCGNRLFELGLGPIALALCGASGPA
AQSLIDRVLSKHGQDSFVFRFLGARGLDWAAELLQQFPQPTKEQSP
 
Nucleotide Sequence: 2451 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5222139-5224589 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCTGAACCTTTCGGAATATCGCGGCAAGGCCGACCGGCTTGCCGACCATCTGCCCTGGGCAGCACTGG
TGGCGCCCGGCATCGTGCTCAACAAGGACGGCAGCGTTCAGCGGACTCTTCGATTTCGCGGGCCCGATCT
GGAAAGCTCGACCGAAGCCGAACTCCTCGGCATCTGCGCCCGGGCCAACAATGCGCTTAGACGCCTTGGC
TCCGGCTGGACATTGTTTTTCGAGGCCGAGCGCATCGAAGCGCTGGGCTATCCGTCCTCGCGTTTCCCGG
ACGCGGCGTCATGGCTGGTTGATGAAGAACGGCGTGCTGCCTTCGAAGGCAAGGTCGCGCATTTCGAGAG
CCGCTGTCACCTGACCTTGCTGTCCATGCCGCCACCGGACGCCCAGGCGCGGGCGGAAAGCGCGCTCGTC
GACTCGCATCATTCAGAAGGCGAAAGAGACTGGCGCCAGGAGATGGCGCGGTTCCGTGACGAGACCGACC
GTGTGCTGGATCTTCTGTCGGGCTTCATGCCCGAAGTGCGTCCGCTCGATGACGCCGAGACGCTGACATA
CCTGCACGACACGATCTCGACCCGCCGCCATCCGGTCGCCGTGCCGGAAACGCCAATGTATCTGGACGGC
ATCCTGGTCGATGTGCCGCTTACCGGCGGCTTGGAGCCGATGCTCGGTGAGCAACATCTTCGCACCCTTA
CCATCCTCGGCTTTCCGAACCTCACCCGGCCCGGAATCCTCGATGCCCTCAATCATCAGGATTTCGCCTA
TCGCTGGATGACGCGCTTCATTCCGCTCGACAAGACCGAGGCCACCAAGACGCTGACCCGCTTGCGCCGG
CAGTGGTTTGCCAAGCGCAAATCGATCGTCGCAATCCTGCGCGAGGTTGTAAGCAACGAACCCGTTCCGC
TCGTCGACAGCGACGCCGACAATAAGGCGCTCGACGCCGATGAAGCACTTCAGGCGTTGGGCGGCGATCA
TGTCGGCTTCGGGTATCTCACTGCAACGGTGACGGTATGGGACGAGGATCGCCAAGCCGCCGCTGAGAAA
CTTCGCGCGGTCGAGCGCATCATCAATGGGCTCGGGTTCACCACCATCCGCGAAAGCGTCAATGCGGTCG
AAGCCTGGCTCGGCTCGCTGCCGGGTCATGTCTATGCCAACGTTCGTCAGCCGCTCGTTCACACGCTGAA
CCTTGCCCATCTCATGCCGCTTTCCTCGGTGTGGGCCGGTCCTGCGGCGAACGAGCATCTGGCTGAAGTC
ACTGGACGAGAGGCCCCGCCGCTCCTCATCGCCGAAACCAGCGGGTCGACTCCGTTCCGGCTTTCTTCCC
ATGTCGAAGATGTCGGCCACATGCTGATCGTTGGACCGACCGGCGCCGGAAAATCGGTGCTGCTTGCCCT
GATCGCCCTGCAGTTTCGTCGCTATGCCGGCGCGCAGGTCTATGTCTTCGACAAAGGCAATTCGGCGCGC
GCGGCAACGCTCGCCATGGGTGGAGAGCATCATGTCTTGGGTTCGGACGGTGCGCTTGCCTTCCAGCCAC
TGCGCAATATCGGTGATCAGGGTAGGCGCAGCTGGGCAGCTGAATGGATCGCCGGCCTGATTGCCCATGA
GAACGTCACCCTCACGCCGGAGGTGAAGGAGGCGATCTGGTCGGCGCTCAACAGCCTCGCCACCGCGCCG
GCGCAGGAGCGCACGCTGACCGGTCTGTCGGTCCTGCTTCAGTCCAATGCACTGAAGTCCGCCTTAATGC
CCTACACGCTCGACGGTCCCTTCGGCCGATTGCTCGATGCCGACGACGATCGGCTGGCCTTGTCGGATGT
GCAGTGCTTCGAGACCGAGGAGCTGATGCATAGCCAAAGCGCTGTGCTGCCTGTGCTCACCTATCTCTTC
CATCGCCTTGAGGAGCGGTTCGACGGGCGACCGACGCTGCTCATGCTCGATGAGGCCTGGGTCTATCTCG
ACAATCCGCTTTTTGCTGCCCGCATCCGCGAATGGCTGAAGGTGCTGCGAAAGAAGAACGTATCGGTGAT
CTTCGCCACGCAGTCGCTTGCCGACATCGCCGGCTCTGCAATAGCGCCGGCGATCATCGAGAGCTGCCCA
CAGCGCATTTTTCTCCCCAATGATCGTGCCGTGGAACCGCAGGCACGGACTGCCTACGAGCGCTTCGGTC
TCAACGACCGGCAGATTGAACTGATCGCCCGGGCCACGCCGAAGCGGCACTACTATTTGCAGTCGCGCTG
CGGCAACCGTCTCTTCGAGCTCGGGCTCGGCCCCATCGCGCTTGCACTTTGCGGCGCCTCGGGTCCAGCC
GCGCAAAGCCTGATCGACAGGGTCCTGTCCAAGCACGGGCAGGACAGCTTTGTCTTTCGCTTCCTCGGCG
CCCGCGGCCTGGATTGGGCGGCCGAGCTTCTCCAGCAATTCCCTCAACCAACCAAGGAGCAATCGCCATG
A
 Primer design