SecReT4
Protein ID: 13475355
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6401
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5224586..5225311 [+]
Productconjugal transfer protein TrbJ
Component typeTrbJ
UniProt IDQ989J1
KEGG IDmlo:mlr6401
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 241 a.a.     [Download]
>gi|13475355|ref|NP_106919.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MMRRRFLSGLITLSLIAKPMADYVQPAYALIVFDPSNYAQNVLTAARSLEQINNQIQSLQNQATVLQNMA
RNLQGLDFSSVGQLTGSLQRIDGLMDQASGLSFDLNKLQDQWRNQYPESYDATIKVSDVASAARDRWQSA
MQAFRQTMGVQSQIVENVRGDGDLLADLVNRSQGAAGALQASQATNQLLALSTKQQMQIQTLLATQFRAE
AEDAARKAQSEEAARETTKRFLGTGRAYPGN
 
Nucleotide Sequence: 726 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5224586-5225311 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGATGCGGCGCCGCTTTCTCTCGGGCCTGATCACCCTTTCGTTGATCGCCAAGCCGATGGCCGACTACG
TGCAGCCGGCCTACGCGCTCATCGTGTTCGATCCGTCGAACTACGCACAGAACGTGCTCACGGCGGCGCG
CTCGCTGGAGCAGATCAACAACCAGATCCAGTCGCTCCAGAACCAGGCGACCGTGCTGCAGAACATGGCA
CGCAATCTTCAGGGTCTGGATTTTTCTTCCGTGGGTCAGCTTACCGGCTCGCTCCAACGGATCGACGGTC
TGATGGACCAGGCGAGTGGCCTGAGCTTTGATCTCAACAAGCTTCAGGACCAGTGGCGTAATCAATATCC
GGAAAGCTACGACGCCACGATCAAGGTCAGCGATGTGGCGAGCGCCGCACGTGACCGCTGGCAAAGCGCA
ATGCAGGCATTCCGTCAGACCATGGGTGTTCAGTCGCAGATCGTCGAGAATGTTCGCGGTGATGGTGACC
TGCTTGCCGATCTCGTCAACCGCAGCCAAGGCGCGGCCGGTGCGCTTCAGGCAAGTCAGGCCACTAACCA
GCTCCTTGCGCTTTCGACCAAGCAGCAGATGCAGATCCAGACGCTGCTCGCAACGCAGTTCCGCGCTGAG
GCCGAGGATGCGGCGCGCAAGGCGCAGTCCGAGGAGGCCGCGCGCGAGACGACAAAGCGCTTCCTCGGCA
CAGGCAGGGCCTATCCCGGCAACTGA
 Primer design