SecReT4
Protein ID: 13475356
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6402
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5225343..5226665 [+]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ989J0
KEGG IDmlo:mlr6402
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 7.7e-47, Aligned region: 37..262
Protein Sequence: 440 a.a.     [Download]
>gi|13475356|ref|NP_106920.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MNDLGVIDRFMETFIRYIDSGFGLLSGDVAFLTTTLIGIDVTLAGLAWAFGGEPNIFGRLIRKVLYVGVF
AFILNNFKNLADIIYRSFAGLGINASSGNLSADNLLHPGRIAATGFEGAWPLLDQASQLLGFPEFFGNAL
TIFVLLVAWFLVIIAFFILSIQLFITILEFKLTTLAGFILVPFALWNRSAFLAERVLGNVISSGIKVMVL
AVIIGIGSTLFGEFASALQGKEPDLAAAMSQVLGALALLGLGIFGPGIASGLVSGAPQLGAGAALGTTAA
AAGASLVAAGAAFAGARTATGSGLTALRAGTTMGSAASTAWQIGRATSPESGLSGVAAGMHGVTSAAAGA
AMRAARSAAGGFGRSVDAGREAAWTATGGAPTASMTGSPTGPVADAAPGWARRLRSEQTARAHRHTAMQA
VREGDRPGGSANPSLNDKDD
 
Nucleotide Sequence: 1323 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5225343-5226665 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGAACGACCTTGGGGTCATTGATCGCTTCATGGAGACCTTCATCCGCTACATCGATAGCGGGTTCGGTC
TGCTCTCGGGCGATGTCGCCTTCCTTACCACGACCCTGATTGGCATCGACGTCACACTTGCCGGCCTCGC
CTGGGCATTCGGCGGCGAACCCAACATATTCGGCCGGCTCATCCGCAAAGTGCTCTATGTCGGCGTCTTT
GCCTTCATCTTGAATAACTTCAAGAACCTCGCCGACATCATCTATCGGTCTTTTGCCGGTCTCGGCATCA
ATGCGTCATCCGGCAACCTATCTGCCGACAATCTCCTGCATCCGGGCCGCATTGCCGCAACCGGTTTCGA
GGGCGCCTGGCCGCTTCTCGATCAGGCAAGCCAGCTTCTCGGCTTCCCAGAATTCTTCGGCAACGCGCTC
ACCATCTTCGTGCTGCTCGTGGCCTGGTTCCTGGTCATCATCGCCTTCTTCATCCTCTCCATCCAACTCT
TCATCACCATCCTCGAATTCAAACTCACCACTCTGGCCGGATTCATTCTTGTGCCCTTCGCGCTTTGGAA
CCGGTCAGCGTTTCTCGCCGAGCGCGTGCTCGGCAATGTCATCTCGTCGGGCATCAAGGTGATGGTGTTG
GCCGTCATCATCGGCATCGGCTCCACGCTCTTTGGCGAGTTCGCTTCCGCGCTGCAAGGCAAGGAGCCGG
ATCTGGCCGCCGCCATGTCACAGGTCCTGGGCGCCTTGGCGCTCCTTGGTCTCGGCATTTTCGGACCTGG
GATAGCCTCCGGTCTTGTCTCGGGCGCGCCGCAGCTTGGCGCGGGCGCCGCACTTGGAACCACGGCAGCC
GCAGCCGGTGCATCGCTCGTTGCCGCAGGCGCAGCATTTGCCGGCGCGCGCACGGCAACCGGCAGCGGTC
TCACCGCACTCCGTGCCGGCACGACCATGGGGTCAGCGGCTTCTACGGCCTGGCAGATCGGGCGCGCAAC
ATCGCCCGAGTCCGGCCTGTCCGGTGTAGCTGCTGGAATGCATGGTGTGACCAGCGCCGCCGCCGGCGCC
GCAATGCGGGCGGCACGATCTGCCGCAGGAGGCTTCGGGCGCAGCGTTGATGCCGGGCGCGAAGCTGCCT
GGACCGCGACCGGTGGTGCGCCGACCGCATCCATGACCGGAAGCCCTACTGGTCCGGTCGCCGATGCCGC
GCCCGGCTGGGCCAGGCGCCTGCGTTCCGAACAGACAGCCCGTGCCCACCGTCACACCGCCATGCAGGCC
GTCCGTGAAGGCGACAGGCCGGGAGGCAGCGCCAATCCCTCTCTCAACGACAAGGACGACTAA
 Primer design