SecReT4
Protein ID: 13475357
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6403
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5226666..5227391 [+]
Productconjugal transfer protein TrbF
Component typeTrbF
UniProt IDQ989I9
KEGG IDmlo:mlr6403
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 4e-61, Aligned region: 22..225
Protein Sequence: 241 a.a.     [Download]
>gi|13475357|ref|NP_106921.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MLFKRPIQRYGKTPEPVTPYQKAAQLWDERIGSSRVQARNWRFMALGCLTLAAGLSGGLVWQSMQSRVVP
YVVEVDGFGEARAVAPAIRDYEPSDAQIAWHLGRFIQNVRSVSTDPVLVRQNWLSAYDFATDRAALFLNE
YAKANDPFGQIGTRSVSVQVTSVVRASDSSFQVKWAEQVFERGSLASTTRWTAILTIVIRPPSNTDQLRN
NPLGVFINAIDWSRELDSAAPTSVSPKGVHQ
 
Nucleotide Sequence: 726 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5226666-5227391 Mesorhizobium loti MAFF303099 chromosome, complete genome
ATGCTATTCAAGCGACCCATTCAACGTTACGGCAAGACGCCCGAGCCGGTCACGCCGTATCAGAAGGCCG
CGCAGCTCTGGGACGAGCGCATAGGCTCATCTCGAGTGCAGGCCCGCAACTGGCGGTTCATGGCTCTTGG
CTGTCTGACCTTGGCGGCCGGACTTTCCGGCGGACTCGTGTGGCAGTCGATGCAGAGCCGCGTCGTGCCT
TACGTCGTCGAGGTCGACGGCTTCGGCGAGGCACGCGCCGTTGCGCCGGCAATCCGGGACTACGAGCCCT
CCGATGCCCAGATCGCGTGGCATCTCGGCCGCTTCATTCAGAATGTCCGTTCCGTTTCCACCGATCCGGT
GCTGGTGCGGCAGAACTGGCTTTCGGCCTATGACTTCGCCACCGACCGCGCGGCGCTCTTTCTCAACGAG
TACGCCAAGGCGAACGATCCTTTCGGCCAGATCGGCACACGCAGCGTGTCGGTGCAAGTGACCAGCGTGG
TCAGGGCTTCCGACAGCTCGTTCCAGGTCAAATGGGCCGAGCAGGTTTTTGAGCGCGGCAGCCTTGCCAG
CACGACGCGCTGGACCGCGATCCTCACCATCGTGATCCGCCCGCCAAGTAATACTGACCAACTGCGCAAC
AACCCGCTCGGCGTCTTCATCAATGCGATCGACTGGTCGCGCGAGCTCGACAGTGCTGCGCCGACGTCCG
TTTCCCCAAAAGGAGTCCACCAATGA
 Primer design