SecReT4
Protein ID: 13475358
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6404
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5227418..5228416 [+]
Productconjugal transfer protein trbG
Component typeTrbG
UniProt IDQ989I8
KEGG IDmlo:mlr6404
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5e-70, Aligned region: 95..314
Protein Sequence: 332 a.a.     [Download]
>gi|13475358|ref|NP_106922.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MLILSASTAVLSACASKPVPPPEISYDAADFKPAAIEKPPEKPVKIVEVPKPLPLPGQLQPDPGRVADDK
RSPEERVSDANKAATQQPTRYGYVNAVQVYPFADGALYQLYAAPERVTDIALQPGEKLTAVSAGDTVRWV
IGDTVSGTGDNQRTHVLVKPFAPGLNTNLVITTERRTYHLQLQSTEKTSMAAISWTYSEDQIIALRQRNA
QAEAAAPVSSNVTLENIRFRYSISGDTPPWRPTRAFDDGSKVYIEFPRRIDQGEAPPLFIVGADGNNQLV
NYRMRGNYYIVDRLFAAAELRLGTKQQQVVRITRTDGRKPTRRMALFPRLGR
 
Nucleotide Sequence: 999 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5227418-5228416 Mesorhizobium loti MAFF303099 chromosome, complete genome
GTGCTGATCCTGTCGGCCTCTACAGCAGTCCTCTCCGCCTGCGCGTCGAAGCCGGTACCGCCGCCTGAGA
TTTCCTATGATGCTGCCGATTTCAAACCAGCCGCAATCGAGAAGCCGCCGGAGAAGCCGGTCAAGATAGT
CGAAGTGCCAAAGCCGCTGCCGTTGCCAGGTCAGCTACAGCCCGATCCGGGCAGGGTGGCCGATGACAAG
CGCTCTCCTGAAGAACGGGTCTCCGATGCCAATAAAGCAGCGACGCAGCAACCCACCAGGTATGGGTACG
TGAATGCGGTTCAGGTCTATCCATTCGCCGATGGCGCACTCTATCAGCTCTATGCCGCGCCGGAGCGCGT
TACCGATATCGCACTCCAGCCGGGCGAGAAGCTAACAGCCGTGTCGGCCGGCGACACGGTGCGTTGGGTG
ATCGGCGATACCGTCAGCGGCACCGGTGACAATCAGCGCACCCATGTGCTGGTAAAACCCTTCGCGCCGG
GACTTAACACAAATCTGGTGATCACCACGGAACGACGCACCTACCATTTGCAGCTTCAAAGCACCGAGAA
GACCTCAATGGCGGCGATCTCCTGGACCTATAGCGAGGACCAGATCATCGCGCTACGCCAGCGCAACGCT
CAGGCCGAGGCGGCCGCGCCAGTATCGTCGAATGTGACGCTGGAAAACATTCGCTTCCGCTACTCGATCA
GCGGCGACACACCGCCCTGGAGGCCGACGCGCGCGTTCGACGATGGCAGCAAGGTCTATATCGAATTCCC
CCGTCGCATTGATCAGGGCGAGGCGCCGCCCCTCTTCATCGTCGGTGCTGACGGGAACAACCAGCTCGTC
AACTACCGCATGCGCGGCAACTACTACATCGTCGACCGTCTCTTTGCCGCCGCCGAACTGCGGCTCGGCA
CCAAGCAACAGCAGGTGGTGCGCATAACAAGGACCGACGGCCGGAAACCGACGCGGCGCATGGCACTCTT
TCCACGTCTTGGCAGGTGA
 Primer design