SecReT4
Protein ID: 13475359
T4SS name [ID]Trb [317]
Gene symbol-
Locus tagmlr6405
StrainMesorhizobium loti MAFF303099
Repliconchromosome [GenBank: NC_002678] [Browse all T4SS(s) in this replicon]
Location [Strand]5228413..5229642 [+]
Productconjugal transfer protein trbI
Component typeTrbI
UniProt IDQ989I7
KEGG IDmlo:mlr6405
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.3e-58, Aligned region: 225..404
Protein Sequence: 409 a.a.     [Download]
>gi|13475359|ref|NP_106923.1| unnamed protein product [Mesorhizobium loti MAFF303099]
MKGNFMTDTSRPNTPPKLDPEQLQLRASPRRAVRFRRGVIIAIAAVGSGAILGVTMMALQGPAWRIKHQA
EDRYNTERKPPAEGLEALPKDYSGIMPKAPVLGPPLPGDLGRPILERQRQLGIAPGQDISAEEQRLAQQA
IEARESQVLFRIDNRPRQTDVAGGGPSAQQPSEALPQSGATRTSASVAPAEGDQNNQQRKLDFVSQRNTS
GIYNPHALQTPASPYQLMAGSVIAASLVTGINSDLPGLVVAQVTENVHDTVTGSIVLIPQGSRLIGTYDS
VVAFGQRRALLVWQRIILPDGSSIEIDNLPATDTAGYAGLEDKVDFHTWQLIKGVALATLLGVGTELSFG
ENESDLVKAIRESTQQNISQAGQRITEKNLNIQPTIIVRPGWPLRVIVHKDLVLRPYPT
 
Nucleotide Sequence: 1230 bp     [Download]
>gi|57165207|ref|NC_002678.2|:5228413-5229642 Mesorhizobium loti MAFF303099 chromosome, complete genome
GTGAAGGGGAACTTCATGACCGATACGTCCCGCCCCAATACCCCTCCAAAACTCGATCCCGAGCAGCTGC
AGTTGCGAGCCTCGCCCCGCCGCGCTGTCCGATTCAGGCGCGGTGTGATCATCGCCATCGCTGCAGTCGG
ATCCGGTGCCATTCTGGGCGTCACGATGATGGCGCTTCAAGGACCGGCATGGCGTATCAAGCACCAGGCA
GAGGACCGCTATAACACCGAGCGCAAGCCACCCGCCGAGGGACTAGAAGCGCTTCCCAAGGACTATTCCG
GGATCATGCCGAAGGCCCCTGTGCTCGGACCGCCACTGCCCGGCGACCTCGGTCGCCCCATCCTTGAACG
CCAACGTCAGCTCGGCATCGCGCCAGGGCAGGATATCTCCGCCGAGGAGCAGCGCCTTGCCCAGCAAGCA
ATTGAGGCGCGCGAGTCGCAAGTCTTGTTCCGGATCGACAATCGACCCAGACAGACAGATGTCGCCGGAG
GCGGGCCGAGTGCGCAGCAGCCGTCTGAGGCGCTTCCGCAATCCGGAGCGACGCGCACGTCAGCTTCCGT
TGCCCCAGCCGAGGGTGACCAGAACAACCAACAGCGCAAGCTCGATTTTGTCAGTCAGCGAAACACAAGC
GGGATCTACAATCCGCATGCGCTGCAGACGCCGGCCTCGCCCTACCAACTGATGGCCGGCAGCGTGATCG
CGGCCAGTCTCGTCACCGGCATAAATTCCGACTTGCCTGGCCTTGTCGTCGCGCAGGTCACCGAGAATGT
GCACGACACAGTCACCGGCAGCATTGTGCTCATTCCGCAAGGCTCACGCCTCATCGGCACTTATGACAGC
GTCGTGGCTTTTGGGCAGAGGCGCGCATTGCTGGTCTGGCAGCGAATAATCCTGCCCGACGGTTCCTCGA
TCGAAATCGACAATCTGCCAGCGACGGATACTGCCGGCTATGCTGGGCTTGAAGACAAGGTCGATTTTCA
CACCTGGCAGCTGATCAAGGGAGTTGCTCTAGCGACGCTACTGGGCGTTGGTACCGAGTTGAGCTTTGGG
GAAAACGAAAGCGACCTAGTTAAGGCGATCCGGGAATCCACTCAGCAAAACATCAGTCAAGCCGGCCAGC
GCATCACCGAAAAGAACCTGAATATTCAACCCACCATTATCGTCCGCCCCGGTTGGCCCCTACGCGTGAT
TGTACACAAGGATCTTGTGCTGCGCCCATACCCGACTTGA
 Primer design