SecReT4
Protein ID: 13488266
T4SS name [ID]VirB [200]
Gene symbol-
Locus tagmlr9256
StrainMesorhizobium loti MAFF303099
Repliconplasmid pMLa [GenBank: NC_002679] [Browse all T4SS(s) in this replicon]
Location [Strand]235069..235800 [+]
Productconjugal transfer protein
Component typeVirB8
UniProt IDQ981S1
KEGG IDmlo:mlr9256
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2.9e-62, Aligned region: 25..232
Protein Sequence: 243 a.a.     [Download]
>gi|13488266|ref|NP_085797.1| conjugal transfer protein [Mesorhizobium loti MAFF303099]
MSDVKESAGGPAKETESPLPYYVDAAIWEKDIARRNRWSRSLAWCVASVASVIAVAAVGALILALPLKTY
EPYMVVVDKSTGFVEVKRPLADGPLQQDESMGMFDIVRYVKARETYDPKALKDNFDLAQLLSTGDASREL
VELFSPANKVTNPVVLYGRNTVVAVTVKSVTFPNQRTALVRFMTEEKSQANTVQRHWVSLIRFRYTGVPA
KNEIRFQNPLGFQVLEYRRDQETAPAPTAETPQ
 
Nucleotide Sequence: 732 bp     [Download]
>gi|13488050|ref|NC_002679.1|:235069-235800 Mesorhizobium loti MAFF303099 plasmid pMLa, complete sequence
ATGAGCGATGTGAAGGAAAGCGCTGGGGGACCGGCGAAGGAAACCGAGTCTCCATTGCCGTACTACGTGG
ATGCGGCAATCTGGGAAAAAGATATCGCGCGGCGCAATCGCTGGTCGCGATCTCTGGCGTGGTGTGTGGC
AAGCGTCGCCTCGGTCATTGCCGTTGCAGCGGTGGGCGCGCTGATCCTTGCGCTGCCGCTCAAGACTTAT
GAGCCCTACATGGTGGTGGTCGACAAATCCACCGGGTTTGTCGAGGTCAAGCGGCCGCTGGCCGACGGTC
CTTTGCAGCAGGACGAGTCGATGGGGATGTTCGATATCGTCCGTTATGTGAAGGCTCGCGAGACCTACGA
TCCGAAGGCGCTGAAGGACAACTTCGATCTCGCGCAATTGCTGAGCACCGGCGATGCCTCGAGGGAGCTC
GTCGAGCTTTTCAGCCCGGCGAACAAGGTGACGAACCCGGTCGTGCTCTACGGGCGAAACACCGTCGTGG
CTGTGACCGTGAAGTCCGTGACATTTCCCAACCAGAGGACCGCCCTGGTCCGGTTCATGACTGAGGAAAA
GAGCCAGGCGAACACCGTGCAGCGGCATTGGGTGTCGTTGATCCGGTTCCGCTACACCGGCGTGCCAGCT
AAAAACGAGATCCGCTTTCAAAATCCGCTCGGCTTCCAGGTGCTCGAATATCGGCGCGATCAGGAGACGG
CGCCGGCACCCACCGCGGAGACACCGCAATGA
 Primer design