SecReT4
Protein ID: 13488269
T4SS name [ID]VirB [200]
Gene symbol-
Locus tagmlr9260
StrainMesorhizobium loti MAFF303099
Repliconplasmid pMLa [GenBank: NC_002679] [Browse all T4SS(s) in this replicon]
Location [Strand]237941..238987 [+]
Producttype IV secretion system protein
Component typeVirB11
UniProt IDQ981R8
KEGG IDmlo:mlr9260
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.9e-91, Aligned region: 14..316
Protein Sequence: 348 a.a.     [Download]
>gi|13488269|ref|NP_085800.1| type IV secretion system protein [Mesorhizobium loti MAFF303099]
MSGQQRTVFLNKALEPVRRWLDDDRVVEICANGPGLVWVEIVGSTHMEPFDVPELDRAAITYLMERIAAS
SSQSISEENPLLSAALPGGERFQGVLAPATPTGGAFAIRKQVVKDMRLDDYRKRGSFDTISVQDPGELSE
TDSALCEYLDAGKIEDFLRLAVRERYSILLSGGTSSGKTTFLNAILHEVPSDERILTIEDTREVKPRQPN
YLPLVVSKGDQGLAHVTVETLLQAAMRLRPDRIFLGEIRGAEAYSFLRAVNTGHPGSITTIHADSPTGAF
EQLALMVMQAGLGLRKAEIIDYVRAVLPIVIQQTRRGGWRGTSAIWFSRMTEWRAARKVSQNVARIGL
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|13488050|ref|NC_002679.1|:237941-238987 Mesorhizobium loti MAFF303099 plasmid pMLa, complete sequence
GTGAGCGGGCAGCAAAGAACCGTCTTTCTAAATAAGGCGCTGGAGCCGGTGCGGCGCTGGCTCGACGACG
ATCGCGTGGTCGAAATCTGCGCAAACGGGCCTGGACTTGTGTGGGTCGAAATTGTTGGCTCGACACATAT
GGAGCCCTTCGACGTGCCCGAGCTCGACCGCGCCGCGATCACTTACCTCATGGAACGTATAGCGGCATCA
TCCTCGCAATCGATCAGCGAGGAAAATCCCTTGCTTTCGGCCGCCCTCCCCGGCGGCGAACGCTTCCAGG
GCGTGCTTGCGCCGGCGACGCCGACAGGAGGCGCCTTCGCGATCCGCAAGCAGGTCGTGAAGGATATGCG
CCTTGATGATTACCGGAAGCGGGGGTCGTTCGATACGATCTCCGTCCAGGATCCCGGCGAATTGAGCGAG
ACCGACAGCGCCCTTTGCGAATATCTCGACGCCGGCAAGATCGAGGATTTCCTCCGCTTGGCCGTGCGGG
AACGGTATTCGATCTTACTTTCAGGAGGCACATCGTCGGGCAAAACGACGTTCCTGAACGCGATTTTGCA
CGAGGTGCCCTCGGATGAGCGGATCCTCACCATTGAGGATACGAGAGAAGTCAAACCACGCCAGCCCAAC
TATCTGCCCCTCGTCGTGTCAAAGGGCGACCAGGGCCTGGCGCACGTGACCGTTGAAACGCTGCTGCAGG
CGGCCATGCGCTTGCGGCCGGATCGAATCTTCCTGGGCGAGATCCGGGGAGCGGAAGCCTATTCGTTCTT
GCGCGCCGTCAACACGGGCCATCCAGGATCGATCACGACGATCCATGCCGACAGCCCCACCGGTGCGTTC
GAGCAGTTAGCCTTGATGGTCATGCAGGCTGGGCTCGGGCTGAGGAAGGCAGAGATCATCGATTACGTGC
GGGCGGTCCTGCCGATTGTCATCCAACAGACGCGCCGGGGCGGCTGGCGTGGAACTTCGGCGATCTGGTT
CAGCCGCATGACCGAATGGAGAGCCGCCAGAAAGGTTTCCCAGAATGTCGCGCGTATTGGCTTATAG
 Primer design