SecReT4
Protein ID: 13488453
T4SS name [ID]Trb [282]
Gene symbol-
Locus tagmll9604
StrainMesorhizobium loti MAFF303099
Repliconplasmid pMLb [GenBank: NC_002682] [Browse all T4SS(s) in this replicon]
Location [Strand]73631..74407 [-]
Productconjugal transfer protein; TrbG
Component typeTrbG
UniProt IDQ98P56
KEGG IDmlo:mll9604
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.5e-63, Aligned region: 10..226
Protein Sequence: 258 a.a.     [Download]
>gi|13488453|ref|NP_109460.1| conjugal transfer protein; TrbG [Mesorhizobium loti MAFF303099]
MEPRREGYYNAIQIYPWSEGALYQVYAAPGQITDIALEPGETLTGDGPIAAGDTARWIIGDTESGSGIAR
RVHVLVKPSRADITTNLIIATDRRSYMLELRAGAKPYMPAVAWSYPAQKAGTLRAIATTPAIPAVAARNY
RYGLTGDNPPWTPVNVYDDGRRVYVEFPRGIVQGEMPPIFVIGPDGEAEITNSRVYQNVLIVDRLFGAAE
LRLGAGKRQQTVRIVRTDAGRTDGLWPRLGDSSASKVPNSMQRGGLQP
 
Nucleotide Sequence: 777 bp     [Download]
>gi|13195732|ref|NC_002682.1|:c74407-73631 Mesorhizobium loti MAFF303099 plasmid pMLb, complete sequence
GTGGAACCGCGCCGGGAAGGCTACTACAACGCCATTCAAATCTATCCCTGGAGCGAAGGAGCACTCTATC
AGGTCTATGCCGCGCCCGGCCAGATAACGGACATCGCGCTTGAGCCGGGCGAGACCTTGACCGGCGACGG
TCCGATCGCCGCCGGCGACACGGCGCGCTGGATCATCGGCGACACCGAAAGCGGCTCCGGCATTGCCCGG
CGCGTCCACGTCCTGGTGAAACCCTCGCGGGCGGACATCACGACCAACCTCATTATCGCCACGGACCGGC
GCAGCTATATGCTTGAGCTGCGGGCAGGCGCCAAGCCATACATGCCCGCCGTTGCGTGGTCCTATCCGGC
TCAGAAAGCGGGAACCCTCCGGGCCATCGCCACAACACCGGCCATACCGGCCGTTGCGGCACGCAACTAT
CGCTACGGTCTCACAGGCGACAATCCGCCCTGGACGCCGGTGAATGTCTACGACGACGGACGCAGGGTCT
ATGTCGAGTTTCCGCGCGGCATTGTGCAAGGCGAGATGCCGCCGATTTTCGTCATCGGTCCGGACGGCGA
GGCTGAAATCACCAACAGCCGCGTCTATCAAAACGTCCTGATCGTCGACCGGCTTTTCGGCGCGGCCGAA
CTGCGTCTTGGCGCCGGCAAGCGCCAGCAGACGGTAAGGATCGTCCGCACCGACGCAGGACGAACCGATG
GATTATGGCCAAGGCTGGGCGACAGTAGCGCGTCGAAGGTGCCGAACTCAATGCAGAGGGGAGGGCTGCA
GCCATGA
 Primer design