SecReT4
Protein ID: 13488455
T4SS name [ID]Trb [282]
Gene symbol-
Locus tagmll9606
StrainMesorhizobium loti MAFF303099
Repliconplasmid pMLb [GenBank: NC_002682] [Browse all T4SS(s) in this replicon]
Location [Strand]75385..76872 [-]
Productconjugal transfer protein TrbL
Component typeTrbL
UniProt IDQ98P54
KEGG IDmlo:mll9606
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.6e-53, Aligned region: 76..301
Protein Sequence: 495 a.a.     [Download]
>gi|13488455|ref|NP_109462.1| conjugal transfer protein; TrbL [Mesorhizobium loti MAFF303099]
MCAAVGRSARPLPWPRKAVWAPDRRTGLARCFHAQGSIDMGNTGVIDQFLATFTRYIDSGFGLLGGEVAF
VATTLIVIDVTLAALFWSWGADDDILARLVKKTLFVGVFAYLISNWNGLAQIVFESFSGLGLKASGTGFS
AQDLLHPGKVAQTGLDAGRPLLEAISGLMGYVSFFENFIQIACLLFAWALVLLAFFILAVQLFVTLIEFK
LATLAGFVLIPFGLFGKTAFMAERVLGNVISSGIKVLVLAVVIGIGSTLFGEFTQGFGNESPTIDQAMAI
VLAALSLLGLGTFGPGIANGLVAGGPQLGAGAAVGTGLAAGGMAVVGYGAAGLAARGGTAAASGAVSVAR
GGTSLAGGGSAAYMLGAAGQTGAAGIASGLGGIARAGASAAASPLKRAAANTGRSLKSSFASGASSAAEV
TGGSSTMGTIGGAALAAAAPASGAGKPSGSQGQPEWARRLQRTQRVSHGAQTAAHAVRAGDSHGGGASIS
LSEGE
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|13195732|ref|NC_002682.1|:c76872-75385 Mesorhizobium loti MAFF303099 plasmid pMLb, complete sequence
ATGTGCGCGGCTGTGGGCCGATCAGCGCGACCGCTTCCTTGGCCTCGAAAAGCCGTCTGGGCTCCCGACA
GGCGAACCGGCCTCGCCAGATGCTTCCATGCTCAGGGGTCGATAGACATGGGCAATACCGGCGTCATCGA
CCAATTCCTGGCCACCTTCACCCGCTATATCGACAGCGGCTTCGGCCTGCTCGGCGGTGAGGTCGCCTTC
GTCGCCACCACGCTGATCGTCATCGATGTGACGCTTGCCGCGCTCTTCTGGAGCTGGGGCGCCGACGACG
ACATCCTCGCCAGGCTCGTCAAGAAGACGCTCTTCGTCGGTGTCTTCGCCTATCTGATTTCCAATTGGAA
CGGTCTCGCCCAGATCGTATTCGAGAGTTTCTCCGGCCTTGGTCTGAAGGCGAGCGGAACCGGCTTCTCG
GCACAGGACCTGCTGCACCCCGGCAAGGTGGCGCAAACCGGTCTCGATGCGGGACGACCCTTGCTTGAGG
CGATCTCCGGTTTGATGGGCTACGTCTCCTTCTTTGAAAACTTCATCCAGATCGCTTGCCTGCTTTTTGC
CTGGGCGCTTGTCCTGCTCGCCTTCTTCATCTTGGCCGTGCAGCTTTTTGTGACTCTGATCGAGTTCAAG
CTGGCGACCTTAGCTGGCTTTGTGCTGATCCCTTTCGGCCTCTTCGGCAAGACTGCCTTCATGGCCGAGC
GCGTGCTGGGCAACGTCATCTCGTCCGGCATCAAGGTTCTGGTGCTTGCCGTGGTTATCGGCATCGGATC
GACGCTCTTCGGCGAATTCACCCAAGGCTTTGGCAACGAGAGCCCCACCATCGACCAGGCCATGGCGATC
GTGCTGGCGGCGCTGTCACTGCTCGGGCTTGGCACCTTCGGCCCCGGCATCGCCAACGGCCTTGTGGCGG
GCGGGCCGCAGCTTGGCGCCGGTGCGGCCGTCGGCACCGGCCTTGCCGCGGGCGGCATGGCGGTTGTGGG
CTATGGCGCAGCCGGCCTGGCGGCGCGAGGCGGGACAGCCGCGGCCTCGGGCGCGGTGTCAGTCGCGCGT
GGCGGCACGTCACTCGCCGGCGGTGGTTCGGCCGCTTATATGCTCGGCGCCGCCGGCCAGACTGGCGCGG
CAGGCATCGCCTCCGGCCTGGGCGGCATTGCGCGCGCCGGCGCGTCGGCGGCCGCCTCGCCGCTCAAGCG
TGCCGCCGCAAACACCGGTCGATCGCTCAAGTCAAGCTTCGCATCCGGCGCAAGTTCGGCGGCTGAAGTC
ACTGGCGGTTCGTCGACCATGGGAACGATCGGCGGTGCCGCGTTGGCAGCCGCGGCTCCTGCGTCCGGCG
CGGGCAAGCCATCCGGCTCTCAAGGGCAACCGGAATGGGCCAGACGCTTGCAGCGCACCCAGCGCGTCTC
TCACGGCGCGCAGACCGCCGCCCACGCGGTGCGCGCCGGCGACAGCCATGGCGGCGGCGCTTCGATTTCT
CTTTCTGAAGGCGAATGA
 Primer design