SecReT4
Protein ID: 13488459
T4SS name [ID]Trb [282]
Gene symbol-
Locus tagmll9610
StrainMesorhizobium loti MAFF303099
Repliconplasmid pMLb [GenBank: NC_002682] [Browse all T4SS(s) in this replicon]
Location [Strand]80584..80916 [-]
Productconjugal transfer protein; TrbC
Component typeTrbC
UniProt IDQ98P50
KEGG IDmlo:mll9610
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.4e-24, Aligned region: 8..100
Protein Sequence: 110 a.a.     [Download]
>gi|13488459|ref|NP_109466.1| conjugal transfer protein; TrbC [Mesorhizobium loti MAFF303099]
MIRLLSRCRASLAAASVAIAVNLMVAPVAHASGSSMPWEQPLEKILQSVEGPVSKIMAVIIIIVTGLTLA
FGDSSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGALI
 
Nucleotide Sequence: 333 bp     [Download]
>gi|13195732|ref|NC_002682.1|:c80916-80584 Mesorhizobium loti MAFF303099 plasmid pMLb, complete sequence
ATGATCCGCCTGCTTTCGCGCTGCCGCGCCAGCCTGGCCGCGGCCAGCGTCGCAATTGCCGTCAACCTCA
TGGTCGCTCCGGTCGCCCATGCATCGGGCTCCTCGATGCCGTGGGAACAGCCGCTCGAAAAGATCCTGCA
GTCGGTCGAGGGCCCGGTCTCCAAGATCATGGCCGTCATCATCATCATCGTCACCGGCCTGACGCTGGCC
TTCGGCGACAGTTCGGGCGGCTTCAGACGGCTCATCCAGATCGTTTTTGGTCTCTCGATCGCCTTTGCGG
CGTCGAGTTTCTTTCTGTCGTTCTTCTCGTTCGGCGGCGGGGCATTGATCTGA
 Primer design