SecReT4
Protein ID: 145301408
T4SS name [ID]Tra_F [130]
Gene symboltraA
Locus tagASA_P5G024
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]22598..22909 [+]
ProductTraA fimbrial protein precursor
Component typeTraA_F
UniProt IDA4SUC7
KEGG IDasa:ASA_P5G024
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 2.7e-23, Aligned region: 12..100
Protein Sequence: 103 a.a.     [Download]
>gi|145301408|ref|YP_001144247.1| TraA fimbrial protein precursor [Aeromonas salmonicida subsp. salmonicida A449]
MNVALQERTQLNPKHLLRVMALMAVAVLVTLLTFGQAHAVDMLAGQSGTVNDTFGANSTVAKWIILAEVI
IGVASYIKTKNLLLLFGVIIVVVFTTVGFQLAA
 
Nucleotide Sequence: 312 bp     [Download]
>gi|145301385|ref|NC_009350.1|:22598-22909 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGAATGTAGCTCTTCAAGAACGGACACAACTCAACCCAAAACACCTGTTGCGGGTCATGGCACTCATGG
CGGTCGCGGTCCTGGTGACCCTGCTTACCTTCGGTCAGGCTCATGCTGTCGACATGCTGGCTGGGCAATC
AGGTACCGTCAACGATACCTTTGGGGCCAACTCGACCGTCGCCAAGTGGATCATTTTGGCTGAAGTAATT
ATCGGGGTTGCCTCCTATATCAAAACCAAAAACCTGCTGCTGCTGTTTGGTGTCATTATCGTGGTTGTAT
TCACCACTGTTGGCTTCCAGTTGGCCGCATAA
 Primer design