SecReT4
Protein ID: 145301409
T4SS name [ID]Tra_F [130]
Gene symboltraL
Locus tagASA_P5G025
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]22924..23232 [+]
Productconjugal transfer pilus assembly protein TraL
Component typeTraL_F
UniProt IDA4SUC8
KEGG IDasa:ASA_P5G025
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.4e-36, Aligned region: 8..101
Protein Sequence: 102 a.a.     [Download]
>gi|145301409|ref|YP_001144248.1| conjugal transfer pilus assembly protein TraL [Aeromonas salmonicida subsp. salmonicida A449]
MQSEDSINKYRFPKTLSEQRRFLGLPYDEAIPTFIPLAWGLYAGSQMLGICAAALIWFAINTAKKGRGSM
WLYNMLYWYFPTALFRVVFKTIPDSSFRQWIR
 
Nucleotide Sequence: 309 bp     [Download]
>gi|145301385|ref|NC_009350.1|:22924-23232 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGCAATCGGAAGACAGTATTAATAAATACCGCTTTCCGAAAACCTTGAGTGAACAGCGTCGCTTCCTCG
GATTACCGTATGACGAAGCAATACCCACATTTATTCCACTCGCATGGGGACTTTATGCGGGCAGCCAAAT
GCTGGGTATTTGTGCGGCGGCGCTGATTTGGTTTGCGATTAACACAGCAAAAAAAGGGCGAGGGTCAATG
TGGCTCTACAACATGCTCTATTGGTATTTCCCGACCGCCCTTTTTCGCGTGGTATTCAAAACCATCCCTG
ACTCCAGTTTTCGGCAATGGATTAGATAA
 Primer design