SecReT4
Protein ID: 145301410
T4SS name [ID]Tra_F [130]
Gene symboltraE
Locus tagASA_P5G026
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]23235..23801 [+]
Productconjugal transfer pilus assembly protein TraE
Component typeTraE_F
UniProt IDA4SUC9
KEGG IDasa:ASA_P5G026
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 4.9e-69, Aligned region: 1..187
Protein Sequence: 188 a.a.     [Download]
>gi|145301410|ref|YP_001144249.1| conjugal transfer pilus assembly protein TraE [Aeromonas salmonicida subsp. salmonicida A449]
MELSARDSTNKMVAIVIVALLLLLTLSLISTIFLVVQNRYLSTHREKIVTPMAYNAPFVISEANSSASHM
QMMALSFMALRLNVSPATVDAQHDFLLGYVKSSAQPDFKLVLAKDAQQIKRNEVNSAFYQTRLLVFPAQN
RIDVRGVLKTWIGNGKPQSEIKDYSIQIAYENGVTSIVKFWEVTNDKP
 
Nucleotide Sequence: 567 bp     [Download]
>gi|145301385|ref|NC_009350.1|:23235-23801 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGGAATTATCAGCTCGTGACTCAACCAACAAGATGGTCGCTATCGTCATTGTCGCACTATTGCTACTGC
TGACGCTTAGCCTGATATCGACCATTTTTCTGGTCGTCCAGAATAGATATCTCTCCACACACAGGGAGAA
AATTGTCACACCGATGGCATATAACGCCCCGTTCGTGATATCCGAGGCCAACAGTAGCGCCTCCCACATG
CAAATGATGGCGCTCTCGTTTATGGCGCTGCGGCTGAATGTCTCCCCCGCCACCGTCGATGCCCAGCATG
ATTTTTTGCTCGGCTACGTGAAAAGCAGTGCGCAACCGGATTTTAAACTCGTCCTTGCCAAGGACGCCCA
GCAAATAAAGCGCAACGAGGTGAACTCGGCCTTTTATCAAACCCGACTCCTGGTATTCCCTGCCCAAAAT
CGCATTGATGTCCGGGGGGTGCTTAAAACCTGGATTGGTAATGGCAAACCCCAGTCTGAAATAAAAGACT
ATTCAATCCAGATCGCCTATGAAAACGGGGTAACCAGCATCGTTAAATTCTGGGAGGTGACAAATGACAA
ACCGTAA
 Primer design