SecReT4
Protein ID: 145301411
T4SS name [ID]Tra_F [130]
Gene symboltraK
Locus tagASA_P5G027
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]23788..24516 [+]
Productconjugal transfer protein TraK
Component typeTraK_F
UniProt IDA4SUD0
KEGG IDasa:ASA_P5G027
PDB IDNA
Domain hit(s) vs Pfam TraK [PF06586], Evalue: 1.1e-61, Aligned region: 12..231
Protein Sequence: 242 a.a.     [Download]
>gi|145301411|ref|YP_001144250.1| conjugal transfer protein TraK [Aeromonas salmonicida subsp. salmonicida A449]
MTNRKPFHPWRWLPLLVLAVAPTTMAATAVTLTFSPGGHLDLPISNVNPNLIVVPGDRVTNISSAAGLLT
DKKNTQAGAALFSTASDKPFTLYVETRLGQVFSINATPRATEGRSYRLFPTTPTPRPVAKVWETAQPYES
MLVALNRALPEGYGPASIDKEAPFTRAGLQATPDSAWDGNALHIVRYRLTNPLSVPVVLREPDFWMPGTR
AIMVHPRYQRLIAGASTWLYVIRTQEHTDGQH
 
Nucleotide Sequence: 729 bp     [Download]
>gi|145301385|ref|NC_009350.1|:23788-24516 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGACAAACCGTAAGCCGTTTCATCCATGGCGATGGCTCCCTCTCCTGGTGCTCGCCGTCGCCCCCACCA
CCATGGCCGCCACCGCGGTTACCCTGACCTTTTCGCCAGGTGGACACCTGGATTTGCCGATCAGCAATGT
TAATCCCAACCTGATCGTGGTGCCCGGTGATCGCGTGACCAACATCAGCAGCGCAGCGGGCCTGTTGACC
GACAAGAAAAACACCCAGGCAGGCGCGGCACTGTTCTCCACCGCCAGCGACAAGCCGTTCACCCTCTATG
TCGAAACCCGGCTGGGCCAGGTGTTTTCTATCAATGCCACCCCGCGAGCCACCGAGGGGCGCAGTTACCG
CCTGTTTCCCACCACCCCGACACCCCGCCCGGTCGCCAAGGTGTGGGAAACCGCCCAGCCCTACGAATCC
ATGCTGGTTGCGCTCAATCGCGCACTGCCAGAAGGTTACGGCCCCGCCAGCATCGACAAAGAAGCCCCCT
TCACTCGCGCCGGGTTACAGGCCACGCCCGATTCCGCATGGGATGGCAACGCATTGCACATTGTGCGCTA
CCGCCTGACCAACCCGCTCTCTGTGCCGGTGGTATTGCGCGAACCGGATTTCTGGATGCCTGGTACCCGC
GCCATCATGGTGCACCCCAGATATCAGCGCCTGATCGCCGGGGCATCGACCTGGCTCTATGTGATCCGCA
CACAGGAGCACACCGATGGCCAACATTAA
 Primer design