SecReT4
Protein ID: 145301412
T4SS name [ID]Tra_F [130]
Gene symboltraB
Locus tagASA_P5G028
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]24503..25831 [+]
Productconjugal transfer pilus assembly protein TraB
Component typeTraB_F
UniProt IDA4SUD1
KEGG IDasa:ASA_P5G028
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.1e-39, Aligned region: 199..395
Protein Sequence: 442 a.a.     [Download]
>gi|145301412|ref|YP_001144251.1| conjugal transfer pilus assembly protein TraB [Aeromonas salmonicida subsp. salmonicida A449]
MANINAITKRKQIMLASSVALIVVAGGAGGWYLSTMDQRNAAKAAQSEPAPDMTGVVNAQFDDKVQQSAV
TEFQLINKEVRQQLAAMRTEMAMMSRERKNDQERLASLEAENKELKAATASGPSLQAPTGEPAPSSANPA
QMANGNIPPPTAFYPGMGNVQPGQMTIQPMAPVQPVNAIDSTTFSYDDDQPSQAPRYPYIPSGSFAKAVV
IEGADTNAAVTGQQNTSPMQLRLTGKVQMPNDHEYDLTGCFVTLEAWGDVSSERAIVRTRGISCKKSNDV
IDQKIAGHVSFMGKNGIKGEVIMRNGQILGWAWGAGFIDGVGKGIEKSASPQVGIGATATMNGGDIAKAG
IGGGAGQAAKTLSDYYIKRAEQYHPIIPIGAGNEVTMVFQDGFQLETIAEAALKKANKAPVPQQDDVLAD
PTVTRSFKDMKVGDLVDPPLHQ
 
Nucleotide Sequence: 1329 bp     [Download]
>gi|145301385|ref|NC_009350.1|:24503-25831 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGGCCAACATTAATGCGATAACCAAGCGCAAACAGATCATGCTCGCCTCATCCGTCGCGCTGATCGTCG
TCGCTGGCGGTGCGGGTGGGTGGTATCTGTCCACCATGGATCAGCGCAACGCCGCCAAGGCGGCCCAAAG
CGAACCAGCCCCAGACATGACCGGGGTCGTCAATGCCCAATTTGATGACAAGGTACAGCAGTCGGCTGTC
ACCGAGTTTCAGCTCATCAACAAGGAAGTGCGCCAGCAGCTGGCCGCCATGCGCACAGAAATGGCCATGA
TGTCCCGTGAGCGCAAAAATGATCAGGAGCGTCTGGCCTCACTGGAAGCCGAAAACAAGGAGCTCAAAGC
CGCCACCGCCTCCGGTCCCTCGCTACAGGCCCCCACTGGCGAACCCGCCCCCAGCTCGGCAAATCCGGCG
CAAATGGCCAACGGCAACATCCCGCCGCCAACCGCCTTTTATCCCGGCATGGGTAACGTCCAGCCAGGGC
AAATGACCATTCAACCAATGGCCCCGGTGCAGCCGGTCAATGCCATCGATTCCACCACGTTCAGTTATGA
CGACGACCAGCCCAGCCAGGCCCCCAGGTACCCCTACATTCCGTCCGGATCATTTGCCAAGGCGGTTGTC
ATTGAGGGGGCAGATACCAACGCCGCAGTCACCGGCCAGCAGAACACCTCCCCGATGCAACTACGCCTGA
CTGGCAAAGTGCAAATGCCAAACGATCACGAATACGACCTGACCGGCTGTTTTGTCACCCTGGAAGCGTG
GGGGGATGTCTCCAGTGAGCGGGCCATCGTCCGCACACGCGGGATCAGCTGTAAAAAGAGCAACGACGTG
ATCGACCAGAAGATCGCCGGTCACGTCTCGTTCATGGGAAAAAACGGCATCAAGGGCGAGGTCATTATGC
GTAACGGCCAGATCCTGGGCTGGGCCTGGGGGGCAGGCTTCATTGATGGCGTGGGTAAGGGCATCGAAAA
ATCAGCCAGTCCGCAAGTGGGTATCGGGGCTACCGCGACCATGAATGGCGGCGACATAGCCAAAGCAGGC
ATAGGCGGCGGCGCAGGACAGGCGGCCAAAACCCTCTCTGACTACTACATCAAACGCGCCGAGCAGTACC
ACCCCATCATCCCGATTGGTGCGGGCAATGAAGTCACGATGGTGTTTCAGGACGGGTTCCAGCTCGAAAC
CATCGCCGAGGCCGCACTCAAAAAAGCCAATAAAGCACCGGTGCCACAACAGGACGATGTGTTAGCCGAT
CCCACTGTCACCCGTTCATTCAAAGACATGAAAGTGGGCGATCTCGTTGACCCCCCACTCCATCAATGA
 Primer design