SecReT4
Protein ID: 145301413
T4SS name [ID]Tra_F [130]
Gene symboltraV
Locus tagASA_P5G029
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]25843..26394 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDA4SUD2
KEGG IDasa:ASA_P5G029
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 4.6e-40, Aligned region: 22..176
Protein Sequence: 183 a.a.     [Download]
>gi|145301413|ref|YP_001144252.1| conjugal transfer protein TraV [Aeromonas salmonicida subsp. salmonicida A449]
MKRFLCLSVFCALLGGCAGSASEFECNATTSDRCMTMEQANEMARKKTEGDTRGKQAAGGLPALVELPAP
SVSPLETPVMTSVPAQSATTMPPSARISPTPRPLTTDAPSSSPLRTTLPVLSNEVCAPPRCDNLGEATPL
RLIDATASVWIAPWIDASDVFHQPGRVSFVVTPGTWQLPQQLK
 
Nucleotide Sequence: 552 bp     [Download]
>gi|145301385|ref|NC_009350.1|:25843-26394 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGAAACGATTTTTATGCCTGTCCGTATTCTGTGCCCTGCTGGGCGGGTGTGCGGGTAGCGCCAGCGAGT
TTGAATGCAATGCCACCACCAGTGACCGTTGCATGACCATGGAGCAGGCGAACGAGATGGCCCGCAAAAA
GACCGAAGGGGACACCAGGGGAAAGCAGGCTGCGGGCGGGTTGCCCGCCCTGGTTGAGTTGCCAGCTCCC
TCTGTCTCGCCGCTCGAAACCCCCGTCATGACCTCCGTGCCCGCCCAATCTGCGACCACGATGCCCCCGT
CAGCGCGCATCAGTCCGACGCCGCGCCCGCTCACCACCGATGCGCCGTCGTCCTCACCGCTGCGCACTAC
GTTGCCCGTGTTGAGCAATGAAGTCTGTGCGCCGCCGCGTTGCGACAATCTGGGCGAAGCCACGCCCCTG
CGTCTGATAGATGCCACGGCTTCGGTCTGGATCGCCCCCTGGATTGATGCCTCCGACGTGTTTCACCAGC
CCGGACGGGTCTCCTTTGTGGTCACGCCAGGCACCTGGCAGTTACCGCAGCAGTTAAAGTAA
 Primer design