SecReT4
Protein ID: 145301414
T4SS name [ID]Tra_F [130]
Gene symboltraC
Locus tagASA_P5G030
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]26405..28990 [+]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDA4SUD3
KEGG IDasa:ASA_P5G030
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.7e-56, Aligned region: 32..271
AAA_10 [PF12846], Evalue: 4.9e-43, Aligned region: 474..764
DUF87 [PF01935], Evalue: 4e-06, Aligned region: 477..662
Protein Sequence: 861 a.a.     [Download]
>gi|145301414|ref|YP_001144253.1| conjugal transfer ATP-binding protein TraC [Aeromonas salmonicida subsp. salmonicida A449]
MDVITATVERLLAAIKKPVGAVQANKILGDLHYPQLSSMLPYRFYDADSGLYVNKSTVGFMLEATPLIGA
NEHIVQVLDDLVKSKLPRKVPISVHLVSTKVIGDQIDHGIAQFSWQGKHAERFNRITRAFYHSAAHGRFG
SPTNLPLTLRDYRVYISYCAKAKKLDKTAITELSHLLKIVRASLESAKIATAQVDQTAFVNIINQMANHR
PEQIIATPKNLQQYDELNFQCLDRSTSLEVKPDYLLLTLDAGDGQKSRARIMNFMLEQNPDLFMLWQGGD
NISNLLSPDLCVASPFVLTMTLEAEEQVSTQNEATRKFFDLDKKANSPYGKLFPGVGKQAQEWGALRENL
NSNSSCLVRYFFNLTAFCPDDEEAALICEQQVINTFKKNGLHLYSPVFMQMRNYLAMFPFCAGEGLWDDL
KASGATSRAESTQAVNLLPLVADNRLCQSGLLAPSYRNQLAFLDIFDTGLGNTNYNMAVSGTSGAGKTGL
VQPILRSVLDSGGSVWVFDMGDGYKSFCENVGGTYLDGQNLKFNPFANITNIHASGERIRDQLSVLASPN
GKLDEVHEDLLLRGILNAWNVKQQKARIDDVVAFLKTERDHEHYANSASITSRMDEIIELLGKYCSTGIY
GEFFNSDSPSLTDDANMVVLELGGLQDKPSLLVAVMFSLIIYIEDKMYRSDRSLKKVCCIDEGWKLLNFK
NDKVGSFIETGYRTVRRHTGSFITISQNIKDFDADDASSAAKAAWGNSAFKVVLKQDASEFKIYNQNRPN
QFSELERLAISRFGDAKDQWFSSFMLRINDTSSFHRLFVDPLSRAMFSSNGKDFEFLQQRRAEGVDIHDA
VYELALLRFPDEMEALASWHH
 
Nucleotide Sequence: 2586 bp     [Download]
>gi|145301385|ref|NC_009350.1|:26405-28990 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGGATGTTATTACTGCAACCGTTGAGCGCCTTTTGGCGGCCATCAAAAAACCGGTAGGTGCGGTGCAAG
CCAATAAGATATTGGGCGACCTGCACTATCCCCAGCTATCCAGTATGTTGCCATATCGCTTTTACGATGC
CGATAGCGGGCTATACGTGAACAAAAGCACGGTCGGCTTTATGCTCGAAGCCACCCCCCTCATCGGGGCT
AATGAGCACATCGTCCAGGTGCTCGATGATCTGGTCAAAAGCAAACTGCCACGCAAGGTGCCTATCTCGG
TGCATCTGGTGTCGACCAAGGTTATTGGTGACCAGATTGATCACGGCATTGCCCAATTCAGTTGGCAAGG
CAAACATGCCGAGCGCTTTAACCGCATCACGCGGGCCTTTTACCACAGCGCTGCCCATGGCCGGTTCGGC
AGCCCCACCAATTTGCCGCTGACCTTGCGCGATTATCGGGTCTATATCTCCTATTGCGCCAAAGCCAAAA
AACTCGACAAGACCGCGATTACCGAGCTGAGCCACCTGCTCAAAATTGTTCGCGCATCCCTGGAATCCGC
CAAGATCGCCACCGCGCAGGTAGACCAGACGGCATTCGTGAACATCATCAACCAGATGGCCAACCACCGG
CCCGAGCAGATCATCGCCACGCCCAAAAACCTCCAACAGTACGATGAACTCAATTTTCAGTGCCTTGACC
GCAGCACCAGTCTCGAAGTGAAACCGGATTATCTGCTGCTAACCCTGGATGCGGGTGATGGCCAAAAATC
CCGTGCCCGGATCATGAATTTCATGCTGGAGCAAAACCCGGACCTGTTCATGCTCTGGCAAGGGGGGGAT
AACATCAGCAACCTGCTCAGCCCCGATCTCTGCGTGGCCAGCCCCTTTGTGCTGACCATGACCCTGGAAG
CCGAGGAGCAGGTGTCCACCCAAAACGAAGCCACTCGCAAATTCTTCGACCTCGATAAAAAGGCCAACTC
CCCTTATGGCAAGCTCTTTCCCGGCGTGGGCAAACAGGCCCAGGAGTGGGGGGCGCTGCGGGAAAACCTC
AACAGCAATAGCAGCTGTCTGGTGCGCTATTTCTTCAACCTGACCGCATTTTGTCCCGATGATGAAGAGG
CGGCCCTCATCTGTGAACAACAGGTGATCAACACCTTCAAGAAAAACGGCCTGCACCTCTACAGCCCGGT
TTTCATGCAGATGCGCAACTACCTGGCCATGTTCCCGTTCTGTGCCGGTGAGGGATTGTGGGATGATCTG
AAAGCCTCCGGGGCCACCTCCCGCGCCGAAAGCACTCAGGCGGTCAACCTGCTGCCACTGGTCGCCGATA
ACCGGCTGTGCCAAAGTGGCCTGCTCGCCCCCTCCTACCGTAACCAATTGGCCTTTCTCGATATTTTCGA
CACGGGCCTTGGCAACACCAACTACAACATGGCGGTCAGCGGGACCTCCGGGGCCGGTAAAACCGGCCTG
GTGCAACCCATCTTGCGCAGTGTGCTCGATTCGGGCGGCTCGGTCTGGGTATTTGACATGGGGGATGGCT
ACAAGAGCTTTTGTGAAAACGTCGGCGGGACCTATCTCGACGGCCAGAACCTCAAGTTCAACCCCTTTGC
CAACATCACCAATATTCATGCCTCCGGTGAGCGGATCCGTGATCAGCTGTCGGTACTGGCCAGCCCTAAC
GGCAAGCTCGATGAAGTGCATGAAGATCTGTTGCTACGCGGGATCCTCAACGCCTGGAACGTCAAGCAAC
AAAAAGCCCGTATCGATGATGTGGTGGCGTTTTTAAAAACCGAACGCGACCATGAGCACTATGCCAATTC
GGCCTCCATCACCTCGCGCATGGACGAGATCATCGAGCTGCTCGGCAAATATTGCTCAACCGGTATTTAC
GGGGAGTTCTTCAACTCAGACAGCCCCTCGCTGACGGACGATGCCAACATGGTGGTGCTCGAGCTCGGTG
GCCTGCAGGACAAACCCTCCTTGCTGGTCGCCGTGATGTTCTCGCTCATCATCTATATCGAGGACAAGAT
GTATCGCTCCGACCGCAGCCTGAAAAAGGTGTGCTGCATCGATGAGGGCTGGAAACTCCTTAACTTCAAA
AACGACAAGGTGGGGTCGTTCATCGAAACCGGTTATCGCACCGTGCGCCGTCATACCGGCTCGTTCATCA
CCATCTCGCAAAACATCAAAGACTTTGATGCCGATGACGCCAGCAGTGCCGCCAAAGCGGCCTGGGGCAA
CTCGGCGTTCAAGGTCGTCCTCAAGCAGGATGCGAGCGAGTTCAAGATCTACAACCAGAACCGCCCCAAT
CAGTTCAGCGAGCTCGAGCGCCTGGCCATCAGCCGCTTTGGCGATGCCAAGGATCAGTGGTTCAGCTCCT
TCATGCTGCGCATCAATGACACCAGTTCGTTCCACCGGCTGTTTGTCGACCCCCTCTCTCGCGCCATGTT
CAGCTCCAACGGCAAGGACTTCGAGTTTCTGCAACAGCGCCGAGCCGAAGGCGTCGACATTCACGACGCG
GTCTATGAGCTGGCACTGCTGCGCTTTCCCGACGAGATGGAGGCCCTTGCATCATGGCACCATTAA
 Primer design