SecReT4
Protein ID: 145301416
T4SS name [ID]Tra_F [130]
Gene symboltraW
Locus tagASA_P5G032
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]29412..30041 [+]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDA4SUD5
KEGG IDasa:ASA_P5G032
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 7.8e-12, Aligned region: 1..31
Protein Sequence: 209 a.a.     [Download]
>gi|145301416|ref|YP_001144255.1| conjugal transfer pilus assembly protein TraW [Aeromonas salmonicida subsp. salmonicida A449]
MRAACVYIALALGGQAHAANLGTWGDLYPITEPDMLTTIHDRLQAMQESGELAEQQEAFKQRVIKNSLRP
APVRGLKLATQNSTHFIDPTFVVGQDLADHEGRVFARKGDKVNPLDSVPFLQTLFFIDADDDRQIAWMRN
QRPATPIYKVILVNGDIRKATEQLDTRIYFDQEGVLSQKFALTAVPAAVHAAPNGKRLQIDTYALEQTP
 
Nucleotide Sequence: 630 bp     [Download]
>gi|145301385|ref|NC_009350.1|:29412-30041 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGAGGGCCGCCTGCGTGTACATCGCCCTGGCCCTCGGTGGTCAGGCCCATGCTGCCAATCTGGGCACCT
GGGGCGATCTCTACCCCATCACCGAGCCGGATATGCTGACCACTATCCATGACCGCCTGCAGGCCATGCA
GGAGAGTGGCGAACTTGCCGAGCAACAGGAGGCATTCAAGCAGCGGGTGATCAAAAACAGCCTGCGACCA
GCTCCCGTCAGGGGGTTAAAGCTTGCTACCCAGAACAGTACCCATTTCATTGATCCCACCTTCGTGGTTG
GACAGGATCTCGCAGATCACGAGGGTCGCGTTTTTGCACGCAAGGGCGACAAGGTTAACCCCCTTGATTC
CGTGCCATTCCTCCAAACTCTCTTTTTCATTGATGCCGATGACGATCGACAAATCGCCTGGATGCGCAAC
CAACGTCCTGCAACACCTATTTACAAAGTCATTCTCGTTAATGGGGATATTCGCAAAGCGACTGAGCAGC
TCGATACCCGCATCTATTTCGACCAAGAGGGTGTACTCAGCCAAAAATTTGCTCTCACTGCCGTTCCAGC
GGCGGTACATGCGGCCCCCAATGGCAAGCGCCTGCAGATCGATACCTACGCGCTGGAGCAGACGCCATGA
 Primer design