SecReT4
Protein ID: 145301417
T4SS name [ID]Tra_F [130]
Gene symboltraU
Locus tagASA_P5G033
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]30038..31027 [+]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDA4SUD6
KEGG IDasa:ASA_P5G033
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.8e-81, Aligned region: 30..328
Protein Sequence: 329 a.a.     [Download]
>gi|145301417|ref|YP_001144256.1| conjugal transfer pilus assembly protein TraU [Aeromonas salmonicida subsp. salmonicida A449]
MIYRITLTLLLFAALNSPPARASAVECEGRFVNPITDICWECLFPISIGSIAVSTGSAPDTSNPSMPIQI
CPMGIFYRVGLAIGYWEPMALTDVTRAPYCLVNMGGISLGVGKVGTGTAGQSDKDAPGAFYHVHWYKYPL
TYWLNIITSMGCLQGGDMDIGYLSELDPTWNDSSIALILSPEAMLFNNVIAQGACAADAMASAFGKPIDA
LFWCAGAHGSMYPFTGYVSNEFSPMQSSILLSERMAAKLHRQGMVMNSIGKDRAVCFEYPSAIVPKERWR
YQMVNKHPDVAACHPFGRTTTRWGTGHNMPNDRKNFGYLLWRKRNCVFL
 
Nucleotide Sequence: 990 bp     [Download]
>gi|145301385|ref|NC_009350.1|:30038-31027 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGATCTACCGCATTACGCTGACCCTGCTGCTGTTTGCAGCGCTCAACAGCCCCCCTGCTCGTGCTTCTG
CAGTCGAATGCGAGGGCCGTTTTGTCAACCCCATCACAGACATCTGCTGGGAATGTCTGTTTCCGATCTC
CATTGGAAGCATCGCGGTCTCCACCGGATCAGCACCCGATACCAGCAACCCCTCAATGCCCATCCAAATC
TGCCCGATGGGGATTTTTTACCGTGTTGGCCTTGCCATCGGTTACTGGGAGCCAATGGCCCTTACGGATG
TGACCAGAGCACCCTATTGCCTGGTTAACATGGGTGGTATCAGCCTCGGAGTGGGCAAGGTAGGAACCGG
CACAGCTGGCCAAAGTGATAAAGATGCCCCGGGCGCTTTCTATCATGTTCACTGGTACAAGTACCCGTTG
ACCTACTGGCTCAACATCATCACCAGTATGGGCTGTCTGCAGGGCGGCGACATGGATATTGGCTATCTGT
CCGAGCTGGATCCGACCTGGAATGACTCCTCTATCGCACTCATTTTGAGCCCCGAGGCCATGCTGTTTAA
CAACGTGATTGCCCAGGGGGCCTGCGCTGCCGATGCCATGGCCAGTGCCTTTGGCAAGCCCATCGACGCA
CTCTTTTGGTGTGCGGGCGCTCACGGCTCCATGTACCCCTTCACCGGCTACGTCAGCAATGAGTTCAGCC
CCATGCAATCCTCCATTCTGCTCTCCGAGCGGATGGCCGCCAAGTTGCACCGCCAGGGCATGGTCATGAA
TTCCATCGGCAAAGACCGTGCCGTCTGTTTTGAGTACCCCTCAGCCATCGTTCCCAAAGAACGCTGGCGT
TACCAAATGGTTAACAAGCACCCCGATGTGGCAGCCTGCCATCCATTTGGCCGCACCACTACCCGCTGGG
GAACCGGCCACAACATGCCTAATGACCGGAAAAATTTCGGCTATCTGCTATGGCGCAAACGCAACTGTGT
TTTTTTGTGA
 Primer design