SecReT4
Protein ID: 145301418
T4SS name [ID]Tra_F [130]
Gene symboltrbC
Locus tagASA_P5G034
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]31037..31645 [+]
ProductTrbC protein
Component typeTrbC_F
UniProt IDA4SUD7
KEGG IDasa:ASA_P5G034
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 6.4e-28, Aligned region: 87..185
Protein Sequence: 202 a.a.     [Download]
>gi|145301418|ref|YP_001144257.1| TrbC protein [Aeromonas salmonicida subsp. salmonicida A449]
MRTYVLSALLILLASPLQASELTAVDTQRFIDDLIANPPSPEQMQQATALGHQANQRQLPENTEWANQLA
RQRDLQTPQGKPTPQAFYFVSFSIPEEGLKRLILDADAFGIPATLRGMVKGDMRETANAVLRLVNEDKRG
GVQIDPKSFGTYGINAVPALVVTCNGQYDRIAGNLALREALTKIAESGDCADTAKAILAAHP
 
Nucleotide Sequence: 609 bp     [Download]
>gi|145301385|ref|NC_009350.1|:31037-31645 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGAGAACCTACGTGCTTAGCGCTTTATTGATCTTGTTGGCTTCCCCCCTGCAAGCCAGCGAGCTGACCG
CTGTCGATACCCAGCGGTTCATTGATGATTTGATTGCCAATCCGCCTTCACCTGAACAAATGCAACAGGC
CACCGCTCTTGGCCATCAAGCAAATCAGCGTCAACTACCAGAGAACACCGAGTGGGCTAACCAACTTGCT
CGTCAGCGAGATCTGCAAACACCGCAGGGTAAACCCACCCCGCAAGCCTTTTACTTTGTCTCCTTCTCAA
TCCCCGAGGAAGGGCTCAAACGTCTCATCCTCGATGCTGATGCTTTTGGCATCCCCGCCACCTTACGGGG
AATGGTAAAGGGCGACATGCGAGAGACCGCCAACGCAGTGCTGCGCCTCGTCAACGAAGACAAACGCGGA
GGCGTCCAGATTGACCCCAAATCATTTGGCACCTACGGCATCAACGCAGTCCCTGCCCTTGTTGTTACAT
GCAACGGCCAATACGACCGCATTGCTGGCAACCTCGCCCTGCGAGAAGCCCTTACCAAGATCGCAGAGTC
CGGTGACTGTGCCGACACAGCCAAAGCCATCTTGGCCGCACACCCCTAA
 Primer design