SecReT4
Protein ID: 145301419
T4SS name [ID]Tra_F [130]
Gene symboltraN
Locus tagASA_P5G035
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]31663..34296 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDA4SUD8
KEGG IDasa:ASA_P5G035
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.9e-69, Aligned region: 319..564
TraF [PF13728], Evalue: 8e-68, Aligned region: 658..867
Protein Sequence: 877 a.a.     [Download]
>gi|145301419|ref|YP_001144258.1| conjugal transfer mating pair stabilization protein TraN [Aeromonas salmonicida subsp. salmonicida A449]
MTFSRPLLTLFLAAMSFSVPVTANEQYNQGSEFAKGIKGQEQSAISGFDPAGSLPSYTNAPSESGYYGGV
TNTSTDLTSQGNAALNQSDAGKAITESILNTPSDNKPSMDAPFISVGTDAWDNAESVTDGSFDGCVEQEV
TSTEYTNHVCSRDTRVDQYCARTATIEGDWVGSTYDYPVTIPHSAIRYAISGSDVTFSFTAPVSGTMRYA
KLHFNRNRNWTHYPTSISFLNSFYPEFKSTGAYPLPGATGMNVVAGATYTGTMRSNHSTGSAASYLYRYF
TEGDYYTYTVEATITVNDQTFSPKIVWRESCPFDKAEGALTGSQCTEPGGNRTIYVEGKPYTMYSDCWAY
KDSYLTQSQSEGSCSQYINDPACTVANRQCAYELDGFCLHENLTYSCEHKTTGSGVMCGGTFFCKDGSCA
QAEAGKNNAFQKAVSELAAVAAAGKDVAELNGADVRAFTGKAQFCKKFAAGFSNCCKDSGWGQDIGLASC
SSEEKALGEARQRKLTIDIGEFCSKKVLGVCVEKKRSYCVFDSKLAQIVQQQGRQWQLGVGFGGASSPDC
RGITVEQLQAINFDNLDFSNFYEDLQNGSTVPEDNALLQRVQQQISGWALRCGIRSPHRASQQASVARQW
GWMLPAMLMLAMPVSAAISAPERNEPQGWQWYNEPQDNTEPQAPAPKQKSASELKKAYQQATQEALDNAI
LNSSPDNFARFMRWQNFWTERAGKFSQSAKSAMLKYPELDYNLKYSHYNGTVKEQLSMDKQKEQAAIAKL
ASQYGIFFFYRGQMPLDNLAGSIIANFAKDNNISIIPVSVDGVLNPALPTSRLDAGQRQRMGIKFFPAIF
LVDPKQHTYRPLAYGFITPDDLSRQFLNVATGFKGEF
 
Nucleotide Sequence: 2634 bp     [Download]
>gi|145301385|ref|NC_009350.1|:31663-34296 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGACATTTTCTCGCCCGCTCTTGACGCTTTTTTTGGCTGCGATGTCATTCTCTGTCCCAGTTACCGCTA
ATGAGCAGTACAACCAGGGCAGCGAGTTTGCCAAAGGCATCAAAGGCCAAGAGCAGTCCGCAATTAGCGG
CTTTGACCCTGCCGGTTCGCTACCCAGCTACACCAACGCACCGTCTGAGTCAGGCTATTACGGGGGCGTC
ACCAACACCTCGACCGATCTGACTTCACAAGGTAATGCCGCCCTGAACCAATCAGACGCAGGTAAAGCCA
TTACCGAGTCCATTCTGAATACACCATCCGACAACAAACCCAGCATGGATGCACCTTTCATCTCTGTGGG
TACTGATGCTTAGGACAATGCCGAAAGCGTGACAGACGGCAGTTTTGATGGCTGCGTTGAACAAGAGGTG
ACAAGTACTGAATACACCAACCATGTTTGCTCGCGGGATACGCGGGTAGACCAATATTGCGCCCGCACCG
CAACCATAGAAGGTGACTGGGTAGGCTCGACCTATGACTATCCCGTCACCATTCCACACAGTGCAATCAG
ATACGCAATATCAGGCTCAGACGTAACATTCAGTTTCACGGCGCCAGTGTCAGGAACAATGCGTTACGCA
AAACTTCACTTCAACAGAAATAGGAATTGGACACATTACCCAACCTCAATTTCATTTCTTAATTCGTTTT
ATCCAGAATTTAAGTCAACAGGGGCGTACCCGTTACCCGGTGCGACGGGAATGAATGTGGTTGCCGGTGC
TACGTATACAGGAACAATGAGATCAAACCACTCAACCGGTAGTGCGGCCTCATACTTATATCGATATTTT
ACCGAGGGTGATTACTATACCTATACAGTTGAGGCCACAATCACCGTAAACGACCAAACATTTAGCCCTA
AAATAGTCTGGAGAGAAAGTTGCCCATTTGATAAAGCCGAGGGCGCATTAACCGGCTCCCAATGTACCGA
GCCAGGCGGTAACAGGACTATTTATGTAGAAGGTAAGCCTTACACGATGTACAGCGATTGCTGGGCTTAT
AAAGACTCTTATTTGACTCAATCTCAAAGCGAAGGCTCATGCAGTCAATATATCAATGACCCTGCTTGTA
CCGTTGCCAATCGACAGTGCGCTTATGAGCTCGATGGCTTCTGTCTGCATGAAAACCTGACCTATTCCTG
CGAGCACAAAACCACCGGTTCCGGTGTTATGTGCGGCGGGACGTTCTTCTGTAAGGACGGCAGCTGCGCA
CAGGCGGAGGCAGGCAAAAACAACGCCTTTCAAAAGGCCGTCTCTGAATTGGCAGCCGTTGCTGCAGCGG
GCAAGGACGTTGCAGAACTCAATGGCGCAGACGTTCGTGCATTCACAGGAAAGGCCCAATTTTGTAAAAA
ATTTGCAGCTGGCTTCAGTAACTGCTGTAAGGATTCAGGCTGGGGTCAAGATATAGGATTAGCCAGCTGC
AGCAGCGAGGAAAAAGCCCTTGGCGAGGCGCGCCAGCGCAAGCTCACCATCGATATCGGCGAGTTCTGCA
GCAAGAAAGTGCTTGGCGTCTGCGTCGAGAAAAAGCGCAGCTACTGTGTCTTTGATTCCAAACTGGCGCA
GATCGTCCAGCAACAAGGGCGACAGTGGCAGCTCGGGGTCGGCTTTGGTGGCGCATCCTCACCTGATTGT
CGCGGGATCACCGTCGAGCAACTCCAGGCAATCAACTTCGACAACCTCGACTTCAGTAACTTTTACGAAG
ACCTGCAAAACGGCTCCACTGTCCCCGAGGACAATGCGCTACTCCAGCGCGTCCAGCAGCAGATATCAGG
CTGGGCTCTGAGGTGTGGTATCCGTTCTCCACACCGAGCGAGCCAGCAGGCAAGCGTAGCGCGGCAGTGG
GGGTGGATGTTGCCCGCCATGCTCATGTTGGCCATGCCGGTCTCTGCCGCCATCTCAGCCCCCGAGCGCA
ATGAGCCGCAGGGCTGGCAGTGGTATAACGAGCCCCAGGACAATACCGAACCGCAGGCACCGGCCCCGAA
ACAAAAATCGGCCAGCGAATTAAAAAAAGCCTATCAGCAAGCAACTCAGGAAGCGCTGGATAATGCCATC
TTGAATAGCTCGCCAGATAATTTCGCTCGCTTTATGCGCTGGCAAAATTTCTGGACTGAGCGGGCGGGGA
AATTTTCCCAGAGCGCCAAGTCGGCCATGCTCAAATACCCAGAGCTCGATTACAACCTCAAATACAGTCA
TTACAACGGCACAGTGAAAGAGCAGCTGTCCATGGACAAGCAAAAAGAACAGGCCGCTATTGCCAAGCTG
GCCTCGCAATATGGCATTTTCTTTTTCTATCGAGGTCAAATGCCACTGGACAATCTCGCGGGTAGCATCA
TTGCCAATTTTGCCAAAGACAACAATATCAGCATTATTCCGGTTTCTGTGGATGGCGTATTAAATCCTGC
GCTGCCAACGTCCCGTTTGGATGCAGGACAACGCCAACGCATGGGCATCAAGTTTTTCCCTGCGATCTTT
CTGGTTGATCCCAAACAGCATACCTATCGGCCCCTCGCCTACGGGTTTATTACCCCGGACGATCTATCGC
GCCAGTTTTTAAATGTCGCCACCGGCTTTAAAGGAGAATTTTAA
 Primer design