SecReT4
Protein ID: 145301422
T4SS name [ID]Tra_F [130]
Gene symboltraH
Locus tagASA_P5G038
StrainAeromonas salmonicida subsp. salmonicida A449
Repliconplasmid 5 [GenBank: NC_009350] [Browse all T4SS(s) in this replicon]
Location [Strand]35154..36518 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDA4SUE1
KEGG IDasa:ASA_P5G038
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 2.1e-118, Aligned region: 27..375
Protein Sequence: 454 a.a.     [Download]
>gi|145301422|ref|YP_001144261.1| conjugal transfer pilus assembly protein TraH [Aeromonas salmonicida subsp. salmonicida A449]
MRPVKQFGYAALMLLSTAVNADVNSDLNDFFGKLGFETNTTMPHAWQGQAAGYASGGSIYMRTAVKQVQL
FSMQVPSLNAGCGGIDAYLGSFSHITGDQLQRFVKQIMGNAAGYFFDLALQTTVPEMKQAKDFLQKLASD
VNSMNMSSCQAAQGIVGGLWPKTAVSQQKICQDISGEQNLFSDWAASRQGCTLGGQYGSVTDKADAKNKD
QVLKNKNLMWESLGKNGLFSSNLELKEFAMSLTGTLIFDDKGEIKPLVALTTNEDIIKAMMNGGSAKIYA
CDTTSLCLNPSIRPVSISEANALSGQVKAMLTSIQNKAISDSPLTEKEKGFISSTSVPVLKYLIDPQSLG
VANSLLYQLSDYISYDILMQYLQELIQQARIMLGSSNYPEPAIEQLHQSLNQSSQNIAVLQSRVQINQSA
LMVVDRQMSYMRQQLSSRLLERYQSNYRFGGAGS
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|145301385|ref|NC_009350.1|:35154-36518 Aeromonas salmonicida subsp. salmonicida A449 plasmid 5, complete sequence
ATGCGACCCGTTAAACAATTCGGTTATGCCGCCCTGATGCTGCTGAGCACCGCCGTCAATGCGGATGTGA
ACAGCGACCTGAACGATTTTTTCGGCAAGCTGGGCTTTGAAACCAACACCACCATGCCCCATGCCTGGCA
AGGCCAGGCCGCAGGCTATGCCAGCGGCGGCTCTATTTACATGCGTACTGCTGTCAAGCAGGTGCAGCTG
TTCTCGATGCAGGTACCCAGCCTCAATGCCGGGTGCGGCGGCATCGATGCCTATCTGGGCTCGTTTTCCC
ATATCACCGGCGACCAGCTCCAACGTTTCGTCAAACAGATCATGGGCAATGCTGCCGGGTACTTTTTCGA
TCTGGCCCTGCAAACCACGGTGCCGGAAATGAAGCAGGCCAAAGACTTTCTGCAAAAGCTCGCCTCGGAT
GTGAACTCCATGAACATGAGCAGTTGCCAGGCGGCACAAGGCATCGTTGGCGGGCTATGGCCAAAAACTG
CAGTCAGCCAGCAGAAGATCTGCCAGGACATCTCCGGGGAACAAAACCTGTTCAGCGACTGGGCCGCCTC
CCGCCAGGGCTGTACCCTCGGTGGCCAATATGGCAGCGTGACCGACAAGGCAGACGCCAAAAACAAGGAT
CAGGTGCTGAAAAACAAAAACCTGATGTGGGAGTCCCTGGGGAAAAATGGCCTGTTCAGCAGTAACCTCG
AGCTCAAAGAGTTTGCCATGAGTTTGACCGGCACCTTGATCTTCGATGACAAAGGCGAGATCAAACCGCT
TGTCGCGCTCACCACCAATGAGGACATCATCAAGGCGATGATGAATGGTGGCAGCGCCAAGATCTACGCC
TGCGATACCACTTCGCTGTGCCTTAACCCGTCCATTCGACCGGTCTCTATCAGTGAGGCCAACGCCCTGA
GCGGCCAGGTGAAAGCCATGTTGACCAGCATCCAGAACAAGGCGATCTCCGACTCGCCCCTGACCGAAAA
GGAGAAGGGCTTTATCAGCTCGACCTCCGTGCCAGTGTTGAAATACCTCATCGATCCGCAATCACTCGGG
GTGGCCAACAGCCTGCTCTACCAGCTCTCCGATTACATCAGTTACGACATTCTCATGCAGTACCTGCAGG
AGTTGATCCAGCAAGCCAGGATCATGCTGGGCAGCAGCAACTACCCTGAGCCTGCCATCGAACAACTCCA
TCAAAGTCTTAATCAGTCCAGCCAGAACATCGCCGTGCTGCAATCGCGTGTCCAGATCAATCAAAGTGCG
CTGATGGTCGTGGACAGACAGATGAGCTACATGCGCCAGCAGCTCTCCAGCCGCTTGCTGGAACGCTATC
AATCCAACTACCGATTCGGGGGCGCAGGATCATAA
 Primer design